KEGG   Brevibacillus brevis: BBR47_15510Help
Entry
BBR47_15510       CDS       T00879                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
bbe  Brevibacillus brevis
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bbe01504]
    BBR47_15510
Enzymes [BR:bbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     BBR47_15510
Antimicrobial resistance genes [BR:bbe01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    BBR47_15510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH DUF1679 Fructosamin_kin EcKinase Choline_kinase
Motif
Other DBs
NCBI-ProteinID: BAH42528
NITE: BBR47_15510
UniProt: C0Z958
Position
complement(1598380..1599264)
Genome map
AA seq 294 aa AA seqDB search
MTTTTQTYIQHIQAMYPELTITSAYFNEMGQNNDVLIVNDAYVFRFPKYTAGIEQLKMET
SILRTVRPYLSLPIPAPIYLSFAEEAPGRVFAGYPLLEGEPFTREAFQAASRQNAVPTVA
TQLAQFLHELHQLPVSSLLPELISDDFDMAKQLTELYEQIASKLFPAMREQAKRDVAERF
EAYLADPAHFDFQPCLTHGDFGTGNILYSPAKQRITGIIDFGGSGVGDPAYDLAGLCASY
GEAFLQHFNPVYPQLEQVMTRMRFYRSTFALEEALFGLTNDDETAYLAGMRDYL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacaacgcaaacgtatatccaacacattcaagcaatgtatccagagttgacc
atcacttccgcctactttaacgagatgggccaaaacaatgatgtactcatcgtcaatgac
gcgtacgtgtttcgttttccgaagtacaccgccggaatcgagcaactgaagatggaaacg
agcattttacgcacggtaagaccatatctctccctgccgattccggctccgatctatttg
tcctttgccgaggaagcacctgggcgagtgtttgccggatatccgctactcgaaggcgag
ccttttacccgagaagcttttcaagcagcctcgcgtcaaaacgcggtaccgactgtcgct
acccagctggcacaatttcttcatgagctgcaccagctccccgtctcctccttgctcccg
gagcttatctctgacgattttgacatggccaagcagttgactgagctgtatgaacagatt
gcttcgaagttgttccctgccatgcgtgagcaagcgaaaagggatgtagctgagcgcttt
gaagcatacctggcagaccctgcccactttgattttcagccttgcttgactcatggagat
tttggcacagggaatatcttgtactccccggcaaaacaacgcatcactggcatcatcgac
tttggcggctctggtgtaggcgatccggcatacgacctcgctggactatgtgcgagctac
ggagaagcgtttttgcagcatttcaacccggtgtacccccagcttgaacaggtgatgaca
aggatgagattttaccgcagtacatttgccttggaagaagcgctgtttggtctgacaaat
gacgatgagacagcttacctagctggcatgcgagactacctctag

DBGET integrated database retrieval system