KEGG   Brevibacillus brevis: BBR47_16600Help
Entry
BBR47_16600       CDS       T00879                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00360  Phenylalanine metabolism
bbe01100  Metabolic pathways
bbe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BBR47_16600
Enzymes [BR:bbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     BBR47_16600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: BAH42637
NITE: BBR47_16600
UniProt: C0Z9G7
Position
complement(1716290..1717666)
Genome map
AA seq 458 aa AA seqDB search
MPTTGFLIRHVQWPLMEALKGNRIRPYMKELQATQRLPAEALAVQQREKLVKLLDHAIQN
VPAYTAFAPDWSNMREMPERFLQRIPVLTKTHFRQNADQYLSQGRQTSRLIGNRTGGSTG
EPTHFYLDRPTVERYEAARWFGLSWYGIRFGDPCVMIWGSPLELNAQQARRYRWKERWLK
NRLMISAYELDERHLEANLRLIREFRPAYLYGYASALHTLAMMMLRRGMGLGIPLKAVVS
TAESLHEQQRQAITQAFDAPVVNEYGARDGGMIAYQCKAGSMHAFSGNCYLEVVDPITHI
PLNNGHPGALLVTDLHNTVMPRLRYQIGDVVALSDSACSCNLPFPLLASIDGREDDMFLS
RNGQYVHGHYFNHIVRNMDSFRTFQIVQHEPERLSLRLVKEPERFLPADEAKLLAGIRAA
LGQVSIHVSYVETIPPASSGKTRYAIREFSLTSAPPLE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcccacaaccggatttttgatccgccatgtacagtggccgctaatggaggctttgaaa
ggaaatcgcatccgtccttacatgaaagaattgcaagcaacacagcgtctacctgccgaa
gcgcttgccgtgcagcagcgagaaaagctggtgaaactactcgatcatgcgatacaaaat
gttccagcttacactgccttcgccccagattggagtaacatgcgcgagatgcctgaacgt
tttttgcagcggattcctgttctgaccaaaacacactttcggcaaaacgctgatcaatat
ttgagccagggccgacaaacaagcaggctcattggcaatcgaacgggaggatccacgggt
gaacctacccatttttacctcgatcgtccaactgtcgagcgatatgaagctgcacggtgg
tttgggctatcctggtacggtattcgctttggtgacccatgtgtgatgatttggggctct
ccactcgaattaaacgcccagcaagctcgccgctaccgctggaaggaacgctggttgaaa
aaccgcctgatgatttctgcctatgaattggacgaaagacatttggaagcaaacctgcgc
ctcatccgggaattccgtccagcctatttatacgggtacgcctccgcgctgcataccctc
gccatgatgatgctacgacgcggcatgggacttggaatcccgcttaaagccgtggtctct
acagcagaaagcctgcacgagcaacaacggcaagcgattacccaagcttttgatgcgcct
gttgtgaatgaatacggcgctcgtgacggcggaatgatcgcctatcaatgtaaagcaggg
agcatgcatgccttttccgggaactgttatttggaggtagtcgatccaattacgcatatt
cccctcaacaatgggcacccaggagcactgcttgtcactgacctgcacaataccgtcatg
cctcgcctgcgctaccaaataggagatgtcgtcgctctttctgattcagcctgctcatgc
aatctcccttttccacttcttgcttcgatcgacggcagagaagacgacatgttcctatca
cgaaacggacagtatgtacacggacattattttaatcacattgttcgcaatatggacagc
tttcgcaccttccagatcgtccagcatgaaccggagcgactgagcctgcgactggtgaag
gagcccgaacgttttttgcctgccgatgaagccaagcttttggcaggaattcgcgcggcg
ttaggtcaagtgagtatccacgtttcttatgtggagaccattcccccagctagctcaggt
aagactcgttatgccatccgggaattctcgcttacgagcgcccccccgctggagtag

KEGG   Brevibacillus brevis: BBR47_50030Help
Entry
BBR47_50030       CDS       T00879                                 

Gene name
paaK
Definition
(GenBank) probable phenylacetate-CoA ligase
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00360  Phenylalanine metabolism
bbe01100  Metabolic pathways
bbe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BBR47_50030 (paaK)
Enzymes [BR:bbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     BBR47_50030 (paaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C_2 AMP-binding LuxE
Motif
Other DBs
NCBI-ProteinID: BAH45980
NITE: BBR47_50030
UniProt: C0Z574
Position
complement(5264932..5266260)
Genome map
AA seq 442 aa AA seqDB search
MIFNTEMETLPREKMTELQLARLKETVKRVYERVPFHTKAFNEAGVKPENIQSIEDIQKL
PFMKKTDLRENYPFNLFAVEMKEVARIHGSSGTKGKPTVVGYTKKDLENWAEIVARAICC
AGGEPGDIFHNAYGYGLFTGGLGLHNGIEHMGAVAVPVSGGNTSRQITLIEDFKPRGIAA
TPSYVLNIVEEMKKQGIDPRETSVKYGIFGAEPWSEEMRVQLEQELDIKAVDIYGLSEVM
GPGVSIECQEAQDGLHIAEDHFYAEIIDPNTGEVLPYGQEGELVFTSLTKEAFPVVRYRT
GDIASLNPEPCKCGRTTMRMSRIKGRVDDMLIIRGVNVFPTEIESVLLTFNQLAPHYQVV
IERDGALDRFEVHCELTPAYAKELSENDSSALSSLVKEICHHIKNTLGVSVVLRVQPPSS
LTRSEGKAIRVVDNRNKSQAAI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgatttttaacacagaaatggaaacgctaccaagagagaaaatgacggaactgcaactg
gcacgcttgaaagaaacggttaaacgcgtatacgagcgcgttcctttccacacaaaagca
ttcaatgaggctggtgtgaaaccagaaaacatccaatcgatcgaagacatacagaagctt
ccctttatgaaaaagactgatttgcgagaaaattatccattcaatctgtttgcggttgaa
atgaaggaagtagcacgcattcatggttcttccggaacaaagggaaaaccgaccgttgtc
ggctacaccaaaaaagacttggagaattgggcggagatcgtggcccgcgccatttgctgt
gcgggtggagagccaggggacattttccataacgcgtatggctacggtctttttacaggc
ggtttgggtctgcacaatggcatcgagcatatgggcgcagtcgcagtgccagtatccggc
ggcaatacctcccgtcaaattacgttgatcgaggacttcaagccacgtggtattgcagca
acgccatcctatgtcctcaacatcgtggaagagatgaaaaagcaaggaatcgatccacgt
gagacgagtgtcaaatacgggatttttggtgcggagccgtggtcggaagaaatgcgcgtg
cagctggagcaagagctcgacattaaagccgtggacatttacggtctgagcgaagtgatg
gggccaggcgtttccattgaatgtcaggaggcgcaggatggcctacatatcgcagaagac
catttctacgcagaaattatcgatccgaataccggagaagtgcttccatacggacaagag
ggcgagctcgtatttacgtcgctgacgaaagaagcattcccggttgtccgctatcgtacg
ggtgatatcgcgtccctcaatcctgagccctgtaagtgcggaaggacaaccatgcggatg
tcgcgcatcaaagggcgtgtagatgacatgctcattattcgcggagtcaatgtgttcccg
acagagatcgagtccgttctgcttacgttcaatcaattggctccacactatcaggtcgtc
attgagcgcgacggtgccctcgaccgttttgaggtgcactgcgagctgacaccagcatat
gcaaaagagctcagtgaaaatgacagctctgctctctcgtcattggtgaaagaaatttgc
catcacatcaaaaatacgttaggtgtgtccgtggtgctgcgggtgcaaccgccaagttcc
ttgacgcgtagcgaaggcaaagcgatacgagtcgtagataatcgaaacaaatctcaggca
gcgatctaa

DBGET integrated database retrieval system