KEGG   Brevibacillus brevis: BBR47_21120Help
Entry
BBR47_21120       CDS       T00879                                 

Gene name
acsA
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00010  Glycolysis / Gluconeogenesis
bbe00620  Pyruvate metabolism
bbe00640  Propanoate metabolism
bbe00680  Methane metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_21120 (acsA)
   00620 Pyruvate metabolism
    BBR47_21120 (acsA)
   00640 Propanoate metabolism
    BBR47_21120 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BBR47_21120 (acsA)
Enzymes [BR:bbe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BBR47_21120 (acsA)
Lipid biosynthesis proteins [BR:bbe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BBR47_21120 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAH43089
NITE: BBR47_21120
UniProt: C0ZBD0
Position
2207988..2209703
Genome map
AA seq 571 aa AA seqDB search
MNVEKIPATEGPYNLKNYDETYANFDWADVEKQFSWYETGKVNMVYEAIDRHLATDRKDK
IALMYSNATRDETYTFAQLSELSNKFGNVLRNLGIVKGDRVFVFMPRSPELYVSVLGTIK
VGAIVGPLFEAFMEAAVRDRLENSEAVAIVTTPALLPRIPVNDLPALKHVIVVGAEEELK
EGHIRFEKAMEEASTELEIEWVDREDGMILHYTSGSTGKPKGVLHVHNAMIQHYQTGKWI
LDLQEDDIYWCTADPGWVTGTSYGIFSPWLNGATIVVRGGRFTPEDWYKVIEKNKVSIWF
SAPTTFRMFMGAGDELVKQFDLSSLRHVLSVGEPLNPEVVHWGMRVFNQRIHDNWWMTET
GAQLISNYRCMAIKPGSMGKPFPGIYAAIIDDRGNELPPNRMGNLAIRTGWPAMMRQIWN
NPAKYEEYFSIPGWYVSGDSAYKDEEGYFWFQGRIDDVINTSGERVGPFEVESKLVEHPA
VAEAGVIGKPDPVRGEIIKAFIALRAGYEPSEALMEEIRKFVKEGLAAHAAPREIEFRDK
LPKTRSGKIMRRVLKAWELGLPTGDLSTMED
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttgagaaaattccagcaacggaaggcccttataatctgaaaaattatgacgaa
acatatgcgaattttgattgggcagatgtggagaagcaattctcttggtatgaaaccggg
aaagtgaacatggtgtatgaagccattgatcgacatctcgctactgatcggaaagacaaa
attgctttgatgtacagcaatgccacgagagacgagacctatactttcgcgcaattaagc
gaattatccaataaattcgggaatgttttgcggaatttgggcattgtaaaaggagaccgc
gttttcgtctttatgccgcgttcgccggagctttatgtaagcgttttaggcacaatcaag
gttggcgcaattgtaggaccgctgttcgaagcgttcatggaagcagctgtgcgtgatcgc
ttggaaaatagcgaagccgttgcgatcgttacgacacctgcactattgccacgcatacct
gttaacgacctgcctgccttaaaacacgtgattgttgtaggtgcagaagaggagctaaaa
gaaggtcacatccgctttgaaaaagcgatggaagaagcctccaccgagctggaaatcgaa
tgggttgatcgtgaggatggaatgatccttcattacacctcaggctcaacgggcaagcca
aagggtgttctgcatgttcacaatgccatgatccagcactaccaaactgggaaatggatt
ctcgacttgcaagaggatgatatttattggtgcacagccgatcctggctgggtaacgggt
acttcttatggcattttttcaccttggttgaatggagcaacgattgtcgtacgtggcgga
cgtttcactccggaagactggtataaagtcattgagaagaacaaagtatcgatctggttc
agtgctccgactacgttccgtatgttcatgggggcaggggatgaactcgtcaagcaattt
gacttatccagtctgcgtcacgtcctgagcgttggagaaccgctcaatccggaagttgtt
cactggggcatgcgggtgtttaatcaacgcattcatgacaactggtggatgacggaaaca
ggtgctcagttgatttctaactatcgctgtatggcgatcaagcctggatcgatgggtaaa
ccgttcccaggtatatacgcagcgattattgacgaccgtggaaatgagctgccaccgaat
cgaatggggaatctggcaatccgtacagggtggccagctatgatgagacaaatctggaac
aacccagcgaagtacgaagaatacttcagcatcccaggctggtatgtatccggggattct
gcatacaaggatgaagaaggctacttctggttccaaggccgtattgatgacgtgatcaat
acttccggtgagcgagtcggtccgtttgaagtagagagcaagctcgtggagcatccagca
gtagccgaagcgggcgtcattggtaaaccagatccggttcgtggtgaaattatcaaagca
ttcatcgcgctgcgggctgggtatgagccaagtgaagcgttgatggaagaaattcgcaag
tttgtgaaagaaggactggctgcacatgctgctcctcgagaaatcgaattccgcgacaag
ttgccaaaaacgcgttccggaaagatcatgcgccgcgtcttgaaagcgtgggaattaggt
ctaccaactggtgacctgtctacgatggaagattaa

DBGET integrated database retrieval system