KEGG   Brevibacillus brevis: BBR47_21290Help
Entry
BBR47_21290       CDS       T00879                                 

Gene name
dck
Definition
(GenBank) deoxyadenosine/deoxycytidine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00230  Purine metabolism
bbe00240  Pyrimidine metabolism
bbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BBR47_21290 (dck)
   00240 Pyrimidine metabolism
    BBR47_21290 (dck)
Enzymes [BR:bbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BBR47_21290 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     BBR47_21290 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Cytidylate_kin2 TsaE AAA_33 RNA_helicase CbiA AAA_28 ArgK RsgA_GTPase NTPase_1
Motif
Other DBs
NCBI-ProteinID: BAH43106
NITE: BBR47_21290
UniProt: C0ZBE7
Position
2223706..2224398
Genome map
AA seq 230 aa AA seqDB search
MSRFQNSTLREKYGIPNNAVITIGGTVGVGKSTFTHALADQLGFRVSVEKVDNNPYLGRY
YNDLSRWGFHLQIFFLAERFKEQKRMFDYGGGFVQDRSIYEDTGIFARMLYEQGNMTEED
YRTYTELFEAMVMTPYFPHPDILIYLEGSFDDIIGRVKERGRPMEQQTPVDYWQDLFSRY
DSWIASFTSCPILRVNINEYDVVDDPSSVESIIARAAEKIRLGRATRFSS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggtttcaaaacagcacgcttcgtgaaaaatacgggataccaaacaacgcagtg
attacgatcggcgggacagtaggggtaggaaaatccacctttacacatgccttggcagat
cagctcggatttcgtgtatctgtagagaaggttgacaataacccgtatttgggccgttac
tataatgatttatcgcgttggggtttccatttgcaaattttctttttggcggaacgcttc
aaggaacaaaaacggatgtttgattatggcggcggttttgtccaagatcgctccatctat
gaggataccgggatttttgcccgtatgctgtacgagcaaggcaacatgacagaagaagat
taccgcacttatacagagctttttgaagcgatggtcatgacgccttacttcccgcatcca
gatattttgatctacttagagggaagcttcgatgatattattggtcgcgtaaaagagcgc
gggcgtccgatggagcaacaaacgccagtggattactggcaagatttgtttagccgctat
gatagctggattgcttcctttacttcctgtccgattttgcgggtcaatattaacgaatac
gacgttgtggatgacccatcttcggtagagagcattattgcgcgggctgctgaaaaaatt
cggcttggacgagctacccgcttttcatcataa

DBGET integrated database retrieval system