KEGG   Brevibacillus brevis: BBR47_24750Help
Entry
BBR47_24750       CDS       T00879                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01130  Biosynthesis of antibiotics
bbe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBR47_24750 (trpC)
Enzymes [BR:bbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BBR47_24750 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth NanE
Motif
Other DBs
NCBI-ProteinID: BAH43452
NITE: BBR47_24750
UniProt: C0ZCE3
Position
2550113..2550913
Genome map
AA seq 266 aa AA seqDB search
MLRKIVEKKREEIARLYTDTTVSALLYATKEVQRPRGFRQALETSVRPVSVIAEVKKASP
SKGLIRPDFQAVTIAKAYQAAQAECLSVLTDESFFQGSLSYLRQIHEVVDRPLLRKDFLL
DEIQVVEARAAGADCVLLIAAILDRETLRHLNQTAEELGMDVLIEVHDKRECELVFQAME
PKLLGINNRNLNTFQTDLAVTHELIAELPASLTIVSESGISTPADIENVQSAGARAVLVG
EHFMRQTDVERAVIDLVGEAAPGVSV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtaaaatcgtggaaaagaaacgcgaggagatcgcacgtctttatacagataca
accgtttcagcattgctttatgcaacgaaggaagttcagcgtccacgcggatttcgtcaa
gcattggagacaagtgtacggcctgtaagcgtgattgccgaagtgaaaaaagcatccccg
tccaaagggttaatccgacctgatttccaggcagtgaccatcgcgaaggcttatcaggcc
gctcaagcagaatgtttgtctgttttgacagacgagtccttttttcaagggagtttaagc
tatctacggcaaattcacgaggtagttgatcgcccgttactcagaaaagactttcttctg
gatgaaattcaagtcgtggaagcaagagcagcaggcgctgattgtgtgttgctcattgct
gcgattctcgatagggaaacgcttcgccacctgaaccaaactgccgaggagctgggcatg
gatgtactgattgaggtccatgacaaacgcgaatgtgagcttgtttttcaagcgatggaa
ccgaaattgcttgggatcaacaatcgaaacttgaatacgtttcaaacggaccttgccgtt
acgcatgagttgattgcagaactacctgcgtcactgacgatcgtgagcgaaagtgggatt
tcgacaccggcggatattgagaatgtacaaagtgcaggagcccgggctgtgctggttgga
gagcatttcatgcgccaaacagacgtcgagcgcgcagttattgatctcgtgggagaagcg
gcaccgggggtgagtgtatga

DBGET integrated database retrieval system