KEGG   Brevibacillus brevis: BBR47_33020Help
Entry
BBR47_33020       CDS       T00879                                 

Definition
(GenBank) probable threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00260  Glycine, serine and threonine metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBR47_33020
Enzymes [BR:bbe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BBR47_33020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_3 DUF2203 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: BAH44279
NITE: BBR47_33020
UniProt: C0ZES0
Position
complement(3518829..3519854)
Genome map
AA seq 341 aa AA seqDB search
MKIDLRSDTVTKPTEEMLRAMAEAEVGDDVYREDPTVNRLEAIAAEILGKEAALFVTSGT
QGNQVAVLTHCVNGDEVIAEADSHIFYYEGGAMSALAGVQTRTLVGERGALRAEEVERAI
RGNNIHFPRTKLICLENTHNRAGGAVISVEQMKNVYDIAQKHGVPVHLDGARLFNAAVAL
GVAVSELSVYADTVQICLSKGLSAPVGSILAGERAFIEEARWWRKKLGGGLRQAGYLAAP
GIIALTQMTDRLAEDHERAQQLAKGLRQLSLQVEQVETNIVLVNTDSIGQTAVAFLERLE
EKGVLAVDFDEYVIRFTTHRHISDQHIKTVVEAVEELLVTV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgatttgcgaagtgataccgttacgaagccaaccgaggagatgcttcgagca
atggcggaagcggaggttggggatgatgtttaccgggaggacccaactgtcaatcgtttg
gaagcgatcgcggctgaaatactcggaaaggaagctgcgctgttcgtaacaagtggcacg
caaggtaatcaggtcgctgttttgacgcattgtgtcaacggagacgaagtcattgcggaa
gcggattcgcacattttttactatgaaggcggcgcaatgtcggcattggctggcgtgcaa
acacggacgctggttggtgaacgcggtgctctgcgtgcagaagaggtagagagggcgatt
cggggcaacaatatccattttcctcggacaaaattgatctgtctcgaaaatacacataat
cgcgcgggcggggcggtaatctctgttgagcaaatgaagaacgtctatgatatcgcgcaa
aaacacggtgttcccgttcatttggacggtgctcgtctcttcaatgcggctgtggcacta
ggtgttgcagtcagtgagctaagcgtttatgccgataccgttcagatttgcttgtccaaa
gggctgagtgctccagttggttccattttggctggtgaacgtgcgtttatcgaagaagcg
agatggtggagaaaaaaattaggcggtggattgcgtcaggcagggtatttggcagcgccg
ggcatcatcgctctgacacaaatgaccgatcgattggcagaagaccatgaacgggcacag
caattggcaaaaggcttgcgccagctatcgcttcaggtggagcaagtcgagacgaatatc
gtgctggtgaatacggactcgattggacaaacagctgtcgccttcttggaacgtttggag
gaaaaaggagtgctcgcggtcgattttgacgagtatgtcattcgctttacgacgcatcga
cacattagcgatcaacatatcaagaccgtggtggaagcagtagaggaattattggtaaca
gtgtaa

DBGET integrated database retrieval system