KEGG   Brevibacillus brevis: BBR47_37340Help
Entry
BBR47_37340       CDS       T00879                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00230  Purine metabolism
bbe01100  Metabolic pathways
Module
bbe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bbe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BBR47_37340 (gmk)
Enzymes [BR:bbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BBR47_37340 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_30 AAA_17 ABC_tran AAA_16 AAA_33 AAA Cytidylate_kin ATP_bind_1 AAA_22 RsgA_GTPase Mg_chelatase MMR_HSR1 AAA_29
Motif
Other DBs
NCBI-ProteinID: BAH44711
NITE: BBR47_37340
UniProt: C0ZG02
Position
complement(3915637..3916257)
Genome map
AA seq 206 aa AA seqDB search
MSMVDRGLLLVLSGPAGVGKGTVCKALREVMPGLVYSVSATTRQPRPGEVEGVNYFFKSQ
EEFKRMIEEDALLEWAEYVGNYYGTPRQFVDDMLNEGRDVILEIEVQGALQVKESFPQGT
FLFLAPPDLNELENRIVGRGTESQEIIRKRMEVARAEIELMDHYDYVVVNDVIESACDRI
QAIITAEHLKKDRQVHKYRKWLQEVE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggttgatcgtggtctccttttggttctttccggaccagctggtgtgggaaaa
ggaacagtatgcaaggcacttcgtgaagtgatgcctggtctggtgtattctgtttccgct
accacacgccagccgcgtcctggagaggtagaaggagttaattacttttttaaaagccag
gaagagttcaagcggatgattgaagaagatgctctcctggaatgggcagaatacgtgggg
aattactacggaacccctcgtcagttcgtggacgatatgctcaatgaagggcgcgatgtc
attcttgagattgaagttcagggtgctcttcaagtaaaagagagcttcccgcaaggtaca
ttcctgttcctggctccgcctgatttaaacgaactggaaaaccggatcgtgggacgcggg
acagaatcacaagagatcattcgcaaacgcatggaagtggcgcgtgctgaaatcgagctc
atggaccactacgattatgtagtcgtcaatgacgtcatcgaatcggcgtgcgatcgtatc
caagcgattattacagcggagcatctgaaaaaagatcgtcaggttcacaaatatcgcaaa
tggttacaggaggttgaatag

DBGET integrated database retrieval system