KEGG   Brevibacillus brevis: BBR47_54930Help
Entry
BBR47_54930       CDS       T00879                                 

Gene name
rpoE
Definition
(GenBank) DNA-directed RNA polymerase delta chain
  KO
K03048  DNA-directed RNA polymerase subunit delta
Organism
bbe  Brevibacillus brevis
Pathway
bbe03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    BBR47_54930 (rpoE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bbe03021]
    BBR47_54930 (rpoE)
   03400 DNA repair and recombination proteins [BR:bbe03400]
    BBR47_54930 (rpoE)
Transcription machinery [BR:bbe03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     BBR47_54930 (rpoE)
DNA repair and recombination proteins [BR:bbe03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      BBR47_54930 (rpoE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HARE-HTH IZUMO
Motif
Other DBs
NCBI-ProteinID: BAH46470
NITE: BBR47_54930
UniProt: C0Z843
Position
complement(5796660..5797220)
Genome map
AA seq 186 aa AA seqDB search
MSQLFAHIDSEKLSEMALVDIAYEILRKTNRTYNFRELMNELVAVRKLTDEQLMAIIAQV
YTEINIDGRFVCLGDNVWGLKRWYPTDTVEETQEGGGTKKKKIVTEDDFDDYDSEDEAVE
EYEDDDVVIFEDEEEFVDEDSEIEEEEIDGEIDEEELEDEEDEMFEEDEELEEEESDEEL
DAEDEK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcaattgtttgctcatattgattccgagaaactgagtgagatggcgttagttgac
attgcgtatgaaattttgcgtaaaactaaccgcacttacaacttccgcgagctgatgaat
gaactggttgcagtacgcaagctgacagatgaacaactcatggcaatcatcgcgcaagta
tacacagaaattaacattgatggccgtttcgtgtgccttggtgacaatgtatggggattg
aaacgttggtacccaactgacaccgtggaggaaactcaagagggtggcggaacgaagaag
aagaaaatcgtcacggaagacgacttcgacgattacgattccgaagacgaagctgtcgaa
gaatacgaagacgacgatgttgtcatctttgaggacgaagaggaattcgtcgacgaagat
tctgaaatcgaagaagaagaaatcgatggagaaatcgacgaggaagaactcgaagacgaa
gaggatgagatgttcgaagaggacgaagagcttgaggaagaggaatccgacgaagagctc
gacgccgaagacgagaaatag

DBGET integrated database retrieval system