KEGG   Brevibacillus brevis: BBR47_54990Help
Entry
BBR47_54990       CDS       T00879                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00071  Fatty acid degradation
bbe00072  Synthesis and degradation of ketone bodies
bbe00280  Valine, leucine and isoleucine degradation
bbe00310  Lysine degradation
bbe00362  Benzoate degradation
bbe00380  Tryptophan metabolism
bbe00620  Pyruvate metabolism
bbe00630  Glyoxylate and dicarboxylate metabolism
bbe00640  Propanoate metabolism
bbe00650  Butanoate metabolism
bbe00900  Terpenoid backbone biosynthesis
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01200  Carbon metabolism
bbe01212  Fatty acid metabolism
bbe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBR47_54990 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BBR47_54990 (mmgA)
   00640 Propanoate metabolism
    BBR47_54990 (mmgA)
   00650 Butanoate metabolism
    BBR47_54990 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBR47_54990 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BBR47_54990 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBR47_54990 (mmgA)
   00310 Lysine degradation
    BBR47_54990 (mmgA)
   00380 Tryptophan metabolism
    BBR47_54990 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBR47_54990 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBR47_54990 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBR47_54990 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbe04147]
    BBR47_54990 (mmgA)
Enzymes [BR:bbe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBR47_54990 (mmgA)
Exosome [BR:bbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBR47_54990 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAH46476
NITE: BBR47_54990
UniProt: C0Z849
Position
complement(5804871..5806049)
Genome map
AA seq 392 aa AA seqDB search
MKTVIVGAARTPFGKFGGSLKALSAVELGSIVIKEAVERAGISGDQVDEVIMGMVLQAGA
GQVPSRQAARKAGLPWNVASETINKVCASGMRAVTMGDQIIRAGDGEIIVAGGMESMSNA
PYALPDARNGMRMGDSTVRDLMMYDGLTCPFHQVAMAVHGSNVAEENGITREEQDAWALR
SQQRAAQAMEKGLFADELVSVSIPQRKGEPLQVTVDEGPRPDTTEEGLAKLPPVYKKDGT
ITAGNAPGINDGAAAMVLMSEAKAQQLGIKPLATILGHAAVGAEAPYIATTPGLAINKLL
EKTGVSLSEIDLFEVNEAFAAVILTSGKIVGWDAEKVNVNGGAIAFGHPIGASGARIIMH
LAYELKRRGGGLGIAAICSGAAQGDAILIKVD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggtcattgtaggggcagcgcgtaccccttttggtaagtttggtggctctttg
aaagcgctatcggcagtagagctcggctctatcgtgatcaaggaagcggtagagcgcgct
ggtatttccggcgatcaggtggacgaagtgatcatgggtatggtcttgcaggcaggtgcg
ggtcaggtgccctcacgccaggcagctcgcaaagctggtttgccgtggaatgtagcgagt
gagacgatcaacaaagtatgcgcgtccgggatgcgtgcagtgacgatgggggaccagatc
attcgggccggggacggagaaatcatcgtcgctggcggcatggagagcatgagcaacgca
ccgtatgcactgccagatgcacgtaacggaatgcggatgggagattcgaccgtacgtgat
ctcatgatgtacgacggcctcacttgcccgtttcatcaagtggcgatggctgttcacggc
agcaatgtggcggaagagaacgggattacgcgagaagagcaggatgcgtgggcgctgcgc
agccagcagagagccgcacaagcgatggaaaaaggactttttgccgacgagcttgtctcg
gtttccattccgcaaagaaaaggggagccgctgcaagtaaccgtcgatgaaggaccacgt
ccggataccaccgaggaaggattggcgaagctgccacccgtgtacaaaaaggacggaaca
atcacggcaggcaatgcaccgggaatcaacgacggggcggcagcaatggtgctgatgtca
gaagcgaaagcacaacagctgggcatcaagccgcttgcgacgatactgggacacgccgcg
gtcggcgcagaggctccttatatcgcgacaactccggggcttgcgatcaacaagctcttg
gaaaagacaggtgtctcgctttcggagatcgatctatttgaggtaaacgaagcatttgcc
gcggtaattttgaccagtggcaaaattgttggctgggacgcagagaaagtgaatgtaaac
gggggagcgattgcgttcggacacccgattggcgcgagtggcgctcggatcattatgcac
ctcgcctatgaattgaaaagacgaggcggcggcttagggatcgcggcaatttgcagcggt
gccgcacagggtgacgccatcttgattaaagtagactaa

DBGET integrated database retrieval system