KEGG   Bacillus beveridgei: BBEV_2081Help
Entry
BBEV_2081         CDS       T05114                                 

Definition
(GenBank) Pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bbev  Bacillus beveridgei
Pathway
bbev00790  Folate biosynthesis
bbev01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbev00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBEV_2081
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbev04147]
    BBEV_2081
Enzymes [BR:bbev01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BBEV_2081
Exosome [BR:bbev04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBEV_2081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AOM83439
UniProt: A0A1D7QWT9
Position
2224621..2224908
Genome map
AA seq 95 aa AA seqDB search
MLLTKEDVKASLKDSNGWELTGEVWITKEFNFNTFPKAVQFVNQIAEIAESRQHHPHITL
DYSKVKIALSTHDEGGLTQKDFDSAHAYDKTSDKM
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgcttttaacgaaagaagatgtgaaagcaagcttgaaagactctaacggttgggaactt
accggtgaggtatggatcacaaaagaattcaacttcaatacatttcccaaggctgttcaa
ttcgtcaatcaaattgccgaaattgccgagtcacgccagcatcatcctcatatcacgctc
gattacagtaaggtcaaaattgctcttagtacccatgatgaaggaggattaactcaaaaa
gatttcgactccgctcatgcgtatgataaaacatcagataaaatgtga

DBGET integrated database retrieval system