KEGG   Bacillus beveridgei: BBEV_2487Help
Entry
BBEV_2487         CDS       T05114                                 

Gene name
cobC
Definition
(GenBank) Alpha-ribazole-5'-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
bbev  Bacillus beveridgei
Pathway
bbev00860  Porphyrin and chlorophyll metabolism
bbev01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbev00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BBEV_2487 (cobC)
Enzymes [BR:bbev01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     BBEV_2487 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AOM83827
UniProt: A0A1D7QXT3
Position
2656739..2657350
Genome map
AA seq 203 aa AA seqDB search
MIDVQEATIYLIRHGATGWNQTGRYLGHTNEPILEESYPVIDKLKTVADSLENPIVTSSD
LLRCTQTASRLFPDTAIHFDHRLREMNFGDWEGKTKEDLKQNPDFDTWLYSFHESTIPNG
EGAAEFSNRVLGWWTEYANRPDLLESSHVIVAHGGVIRVLMTHLTGTGLETFWDWRIPHG
TAIRLTLTKQQDDYLASDWIRLP
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgtgcaggaagcaaccatttacctcatacgccacggtgcaaccggctggaat
cagaccggcagatatttagggcataccaatgagcccattcttgaagaatcttacccggtc
attgataaactgaaaacagtagctgattcacttgaaaatccgatcgtgacatcgagcgat
ttgctccgttgcacgcaaaccgcctcaagactgttccccgatactgccattcattttgac
catcgtttgcgggaaatgaattttggcgactgggaaggcaagacaaaagaagatctcaaa
caaaacccggattttgatacttggctgtactcctttcatgagagtacgatcccgaacggg
gaaggggcggccgaattctccaaccgcgtacttggctggtggactgaatacgccaatcgt
cctgatttgttggaaagttcacatgtcatcgtcgcgcacggcggggtcattcgcgttctg
atgacacatttaaccggtaccggacttgaaacattctgggattggcggatcccgcacggc
actgccatccggctgacgctcacgaagcaacaagatgactacctggcatcggattggatc
cgtttgccctga

DBGET integrated database retrieval system