KEGG   Bacillus beveridgei: BBEV_2737Help
Entry
BBEV_2737         CDS       T05114                                 

Gene name
bdhA
Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)- and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bbev  Bacillus beveridgei
Pathway
bbev00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bbev00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BBEV_2737 (bdhA)
Enzymes [BR:bbev01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BBEV_2737 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BBEV_2737 (bdhA)
    1.1.1.-  
     BBEV_2737 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_N_assoc TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AOM84074
UniProt: A0A1D7QYI1
Position
2934747..2935796
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYKAKDLRVEQVDTPTIKQEHEVKVKVSCCGICGSDLHEYAAGPIFIPVNDPHPI
SGDKAPIIMGHEFAGEVVEVGSKVSRVKVGDHVAIEPILAPSKDGAYVDEKYNLSPFLGF
HGLSGGGGGFSEYTVLGEHMVHPVPEGLSAEQGALVEPAAVALHAVRQSSLKAGDTAAVF
GAGPIGLMVIDALKAAGASTIYAVEVSAARLKKAEELGAIVINPKETDPVAKIHELSGGG
VDFSFEVTGIPAVLKQCLHSTHTGGEMIIVSIWEEEASFQPNDLVIAERTMKGIIAYRNI
YPQVMELMKQGYFSGDQMITSRIGLDDVVDKGFEKLLNDKSQVKIIVTP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccgtttggtataaagcaaaagatctcagagtcgaacaagtggacacaccg
acgatcaaacaagagcatgaggtaaaagtaaaagtcagctgttgcggcatttgcggaagt
gacctccacgaatatgcggcagggccgatctttattcctgtgaacgacccccacccgatc
agtggcgacaaagccccgatcatcatggggcatgagtttgcaggagaagtggtggaagtc
ggctccaaagtaagccgggtcaaggtcggcgatcatgtcgccatcgaaccgattttggct
ccatccaaagatggtgcttatgtcgatgagaagtacaacctctccccattccttggcttt
cacggtctctcaggcggcggtggcggtttcagtgaatacacggtcctcggtgaacatatg
gtgcaccctgttccggaaggattatccgcagaacaaggggcactggtcgagccagcggct
gttgcattgcatgccgtccgccaaagcagtttgaaagccggtgatactgctgccgttttc
ggcgcagggccgattggactgatggtgatcgatgccttgaaagcagccggcgcctcgact
atttatgcggtcgaagtatccgcggcgcgcctgaaaaaagcagaagaacttggcgcgatt
gtgatcaatccgaaagaaacagatcccgtggcaaaaatccatgaactgtcaggcggcggg
gttgatttctccttcgaagtcaccggcattcctgccgttctgaagcaatgtctgcacagc
acccataccggcggtgaaatgatcatcgtcagcatttgggaagaggaagcatctttccag
ccaaatgacctggttattgccgaacggacgatgaaagggatcatcgcctaccggaacatt
tatccgcaggtgatggaactgatgaaacagggttatttctccggggatcagatgatcaca
tcgcgtattggccttgatgatgttgtcgacaaaggctttgagaagcttttaaacgataaa
agccaggtaaagatcatcgtgacaccataa

DBGET integrated database retrieval system