KEGG   Bacillus beveridgei: BBEV_2820Help
Entry
BBEV_2820         CDS       T05114                                 

Gene name
rocF
Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bbev  Bacillus beveridgei
Pathway
bbev00220  Arginine biosynthesis
bbev00330  Arginine and proline metabolism
bbev01100  Metabolic pathways
bbev01110  Biosynthesis of secondary metabolites
bbev01130  Biosynthesis of antibiotics
bbev01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbev00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BBEV_2820 (rocF)
   00330 Arginine and proline metabolism
    BBEV_2820 (rocF)
Enzymes [BR:bbev01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BBEV_2820 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AOM84145
UniProt: A0A1D7QYQ5
Position
complement(3015584..3016489)
Genome map
AA seq 301 aa AA seqDB search
MKKNLSVIGVPMDLGQNRRGVDMGPSAMRYAGVIERLTNQGYDVEDLGDVSIQNPVAKDV
KNDANLKDLDVVVNANKALAKKVKEATAKERFPLVLGGDHSIAIGSLAGVADQYQNMGVI
WYDAHGDLNTGETSPSGNIHGMPLAVSLGIGHPSLTEIGGFAPKIKPENIVIIGARSLDE
GEKELIAEKGIKVFTMHEVDRFGMSNVMSQALDYLKEIKTDGVHLSLDLDALDPQDAPGV
GTPVLGGTSYRETHLAMEMLADADVLTSAEFVEVNPILDVKNRTAEAAVGLIGSLFGEKL
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaatttatctgttatcggtgttccaatggaccttgggcaaaatcgccgtgga
gtcgatatgggcccgagtgccatgcgttatgcaggtgttattgaacggctgacaaaccag
ggctacgacgtggaagaccttggagatgtcagtattcaaaatcccgttgctaaagatgta
aagaatgatgcgaatctgaaagatctggatgtcgtggtgaatgcgaataaggcgttagct
aaaaaagtgaaagaagcaactgcaaaagagcgattcccgttggtcctcggaggtgatcac
agcatagcgatcggctccctcgctggagtggcggatcaatatcagaatatgggtgtgatc
tggtatgatgcacacggggatctgaataccggagaaacttcaccctccggcaatattcac
gggatgccgctcgcggtcagtctggggatcggtcacccatccctgacggaaatcggtggt
tttgcaccgaaaatcaagcctgaaaatatagtcattattggtgcccgctcccttgatgaa
ggtgagaaagaactcattgctgagaaaggaattaaagtcttcacgatgcatgaagtggat
cgctttggcatgtcaaacgtgatgtcacaagcccttgactacctcaaagaaataaagact
gatggtgttcatctgagcctggatctggatgcactggaccctcaggatgctccgggtgtg
gggacgccggttcttggtgggacatcttaccgcgaaacgcatcttgcgatggaaatgctc
gctgatgcagacgttttaacgtctgcggaatttgtagaagtcaatccgattctcgatgta
aaaaaccggactgcggaggcagctgtggggctgatcggttccttgttcggagaaaaatta
ttgtaa

DBGET integrated database retrieval system