KEGG   Bacillus beveridgei: BBEV_2950Help
Entry
BBEV_2950         CDS       T05114                                 

Gene name
mtlD-2
Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
bbev  Bacillus beveridgei
Pathway
bbev00051  Fructose and mannose metabolism
bbev01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbev00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BBEV_2950 (mtlD-2)
Enzymes [BR:bbev01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BBEV_2950 (mtlD-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N UDPG_MGDP_dh_N ApbA Sacchrp_dh_NADP NAD_Gly3P_dh_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: AOM84275
UniProt: A0A1D7QZ40
Position
3158461..3159600
Genome map
AA seq 379 aa AA seqDB search
MKQALHFGAGNIGRGFIGKVLAESGYHVTFVDVNHELIEAIQRDGSFTVYYAEPEKRHFT
IPNISGLDSNLQDQDVVAAIADADLVTTAVGAHILPYIAPLISRGLSARLTQQAGPLNVI
ACENAVGGSDLLKAEVYKELSKEEQQKADEIIGFPNAAVDRIVPNQHQENILDVLVEPFF
EWVVDASTYKGELPAINDIHFVEKLEAYIERKLFTVNTGHALAAYTGYQARLDTVQAAMK
DKQVLRDIRQALAESGDLVSTKHGFDREEHDQYIEKILSRFQNQYIIDDITRVARQPIKK
LGTNERLISPIRQLLELDRPADGLMKGAAAALQYDYEGDEEARELQKRLQEHGPAKTLAG
ITGLDEASPVIQGIVKQMK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcccttcacttcggcgcaggaaatatcggtcgcgggtttatcggcaaagtt
ctcgctgaatccggttatcacgtcacgtttgtggatgtgaaccacgaactgattgaggcg
attcaacgcgatggaagcttcacggtgtattatgccgagcccgaaaaacgtcacttcacg
attccaaacatcagtggcctggattccaacctccaggatcaggacgtagtcgctgccata
gcagatgcggatctcgtcaccactgccgtcggtgcacatatcctcccttatattgcacca
ctcatctcccgggggttgtccgcccgtcttactcaacaagcaggacctctgaatgtgatt
gcctgcgaaaatgccgtcggcggatcagacctcctgaaagctgaagtatacaaggagctt
tcaaaagaggagcagcaaaaagctgatgaaattattggctttccaaatgccgcagtagat
cggattgtcccgaaccagcaccaggaaaacatcctcgatgtcctcgtcgaaccattcttc
gaatgggttgtcgatgcttccacgtacaagggtgaactccctgctattaatgatattcat
ttcgtggaaaaacttgaagcgtatattgaacgaaaactcttcaccgtcaataccggccac
gctctggcagcatataccggatatcaggccagactcgataccgtgcaggcagccatgaaa
gataaacaggtgctgcgcgacattcgtcaggcacttgctgaatccggtgacctcgtttct
actaagcatggctttgaccgggaagagcatgatcaatacatcgaaaaaatactttcccga
ttccaaaatcagtacatcattgatgacattacccgggtcgcccgtcagccgatcaaaaag
cttggcactaatgaacgcctcatcagtccgatccggcagctccttgaactcgaccggcct
gcagatggcctgatgaaaggcgctgcagcagcacttcagtatgattatgaaggggatgaa
gaagccagagaacttcaaaaacgccttcaggagcatggtccggcgaagacgctcgcaggc
attaccggtctcgacgaagccagcccggtcattcaaggcattgtaaaacaaatgaagtaa

DBGET integrated database retrieval system