KEGG   Bifidobacterium bifidum BGN4: BBB_0662Help
Entry
BBB_0662          CDS       T02135                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
bbf00010  Glycolysis / Gluconeogenesis
bbf00520  Amino sugar and nucleotide sugar metabolism
bbf01100  Metabolic pathways
bbf01110  Biosynthesis of secondary metabolites
bbf01120  Microbial metabolism in diverse environments
bbf01130  Biosynthesis of antibiotics
bbf01200  Carbon metabolism
Module
bbf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBB_0662 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    BBB_0662 (ppgK)
Enzymes [BR:bbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BBB_0662 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFL04256
UniProt: I3WH93
Position
807540..808301
Genome map
AA seq 253 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVDLNKGEFAEPRLKILTPSESTPQAIGSVLRKQLEHFEI
PETAPVGISFPAPVKPGQKLNWIANLDQSWVGVDITEALSEECGRPVTVVNDADAAGLAE
QQFGAAKGQEGLVVVTTLGTGIGTALIYDGVLIPNTELGHIELEGGKGDAERYASSAVRE
RKELSYKKWAKRLTKYYSLIEKYFSPSLIVIGGGVSRKSDNFVPFIDIDTPIVPAKLRNE
AGIIGAAYYASTK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgattgataccgctcaagcgtttggcgtggatatcggcggatccggtatcaaggccgct
ccggtcgacctgaacaagggggagttcgccgagcccaggctgaagatcctcaccccgtcc
gagtccaccccgcaggcgatcggatcggtgctgcgcaagcagctcgaacatttcgagatt
ccggagacggctccggtcggcatctctttccccgctccggtcaagcccggccagaagctg
aattggatcgccaacctcgaccagtcgtgggtaggcgtcgacatcaccgaggcgctgtcc
gaggagtgcggccgtccggtcacggtcgtcaatgacgccgatgccgccggcttggcggaa
cagcagttcggcgcggccaagggtcaggagggtctggtcgtcgtgaccacgctcggtacc
ggcatcggcacggcgctgatctatgacggcgtgctcatcccgaacaccgagctcggccac
atcgagttggagggcggcaagggcgacgccgagcgctacgcatcctccgcggtgcgcgag
cgcaaggagctcagctacaagaagtgggccaagcgtctgaccaagtactacagcctgatc
gaaaagtacttcagcccctcgctgatcgtcatcggtggtggcgtgagccgcaagagcgac
aacttcgtgccgttcatcgacatcgatacgccgatcgtccccgcgaagctgcgcaacgag
gccggcatcatcggtgccgcctactacgccagcaccaagtag

DBGET integrated database retrieval system