KEGG   Bifidobacterium bifidum BGN4: BBB_0926Help
Entry
BBB_0926          CDS       T02135                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
bbf00260  Glycine, serine and threonine metabolism
bbf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbf01100  Metabolic pathways
bbf01110  Biosynthesis of secondary metabolites
bbf01130  Biosynthesis of antibiotics
bbf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBB_0926 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBB_0926 (trpA)
Enzymes [BR:bbf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBB_0926 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB
Motif
Other DBs
NCBI-ProteinID: AFL04518
UniProt: I3WI05
Position
complement(1113155..1114027)
Genome map
AA seq 290 aa AA seqDB search
MTNAATTPFGQPLGISHKPSATEAMFDRLKAENKPAFIGYLPYGFPNPDISLDALRTMIE
HGVDAVEIGLPYSDPVMDGPVIQAASQIALNNGESINGVFKAVETVANAGGVPLIMSYWN
LIYHYGVERFACDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSASERLE
LVARNARGFVYAASRMGVTGERDTISASPATLVERSRNAGARNVCVGIGVSTPEQGAKVG
AYADGVIVGSALVHTLLDDDNVTAKAPKEGLRDLAAKVEALSEGIHNESR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgcagcaaccacgccgttcggacagccgctcggcatcagtcacaagcccagc
gcgacggaagccatgttcgaccggctcaaggccgaaaacaagccggccttcatcggatac
ctgccgtatggcttcccgaaccccgacatctcactcgacgcgctcaggaccatgatcgag
cacggcgtcgacgcggtcgagatcggcctgccgtactccgacccggtgatggacggcccc
gtcattcaggcggccagccagatcgccctgaacaacggggaaagcatcaacggcgtgttc
aaggcggtcgagacggtggccaacgccggcggcgtgccactcatcatgagctactggaac
ctgatctaccattacggcgtcgaacggttcgcctgcgatttcgagaacgccggcggtgcc
ggcctgattacccccgacctcatccccgatgaggctggcgagtggatcgaggcttcggat
cgtcacggactcgaccgcatcttcctggtctccccggattcggcctccgaacgtctcgaa
ctggtcgcccgcaacgcacgcggcttcgtctacgcggcatcccgtatgggcgtcaccggc
gagcgcgacaccatcagcgcatcgcccgcaacgcttgtcgagcgttcccgcaacgccggg
gcgagaaacgtgtgcgtgggtatcggcgtatccaccccggagcagggcgcgaaggtcggc
gcctacgccgacggcgtcatcgtcggttctgctctggtgcacaccctgcttgacgacgac
aacgtcaccgcgaaggcgccgaaggaaggactgcgcgacctggccgccaaggtcgaggcg
ctgtccgagggcatccacaacgagtcacgctga

DBGET integrated database retrieval system