KEGG   Bifidobacterium bifidum BGN4: BBB_1017Help
Entry
BBB_1017          CDS       T02135                                 

Gene name
gpmB
Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
bbf00010  Glycolysis / Gluconeogenesis
bbf00260  Glycine, serine and threonine metabolism
bbf00680  Methane metabolism
bbf01100  Metabolic pathways
bbf01110  Biosynthesis of secondary metabolites
bbf01120  Microbial metabolism in diverse environments
bbf01130  Biosynthesis of antibiotics
bbf01200  Carbon metabolism
bbf01230  Biosynthesis of amino acids
Module
bbf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBB_1017 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    BBB_1017 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBB_1017 (gpmB)
Enzymes [BR:bbf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BBB_1017 (gpmB)
Membrane trafficking [BR:bbf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BBB_1017 (gpmB)
Exosome [BR:bbf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BBB_1017 (gpmB)
  Exosomal proteins of melanoma cells
   BBB_1017 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFL04609
UniProt: I3WI96
Position
complement(1220903..1221739)
Genome map
AA seq 278 aa AA seqDB search
MIDEVVFLRHGRTAFNVARRLQGQIDVPLDVIGQWQADQSASELARRYYWAKVANIARHP
DTLAQPGPGAAKSSDIEDYRQVPASSRRMVVVSSDLFRALQTAHAFADMLGLDVTADARL
RERSFGQWEGMTRDEIRAEHADAYDSWRIHTGGELAFGVESRIATGLRGADAVLDLVRGI
NAEHADEPTTLMLVGHGSWHVATIETLLGMDPDNLSNLDGMRNAFWSTLRPVYRPSGGVE
WMMTAFNQGPAVAALCDWENGPQSLHGPHMPMWKPIEG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgattgacgaagtggtgtttctgcggcacggacggaccgccttcaatgtggcgaggcgg
ttgcaggggcagatcgacgtgcccctcgacgtcatcggccagtggcaggccgaccagagc
gcgtcggagcttgcgcgacgctactactgggcgaaggtggccaacatcgcccggcatccg
gatacgctggcccagccggggccgggggcggcgaaatccagcgacatcgaggactaccgg
caggtccccgcatcctcgcgacgcatggtcgtcgtctcgtccgacctgttccgtgcgttg
cagaccgcgcacgcgttcgccgatatgctgggactggacgtgaccgcggacgcgcgcctg
cgcgaacgcagcttcgggcagtgggagggcatgacccgcgacgagattcgagcggagcat
gccgacgcctatgattcgtggcggatccacaccggcggcgagctcgcgttcggcgtggag
agccgcatcgccacaggactgcgcggcgccgatgcggtgctcgacctggtgcgcggcatc
aacgcggagcatgccgatgagccgaccaccctgatgctcgtcgggcacggctcatggcat
gtggccacgatcgagaccctgctcggcatggaccccgacaacctgagcaacctggatggc
atgcgcaacgcgttctggtcgacgctcagaccggtataccggccttcgggcggcgtcgaa
tggatgatgacggcgttcaaccaggggccggcggtcgctgctctgtgcgattgggagaac
ggcccgcagtccctgcacggcccgcacatgccgatgtggaagccgatcgaggggtga

DBGET integrated database retrieval system