KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_127Help
Entry
BGIGA_127         CDS       T02109                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
bbg00010  Glycolysis / Gluconeogenesis
bbg00030  Pentose phosphate pathway
bbg00051  Fructose and mannose metabolism
bbg00680  Methane metabolism
bbg01100  Metabolic pathways
bbg01110  Biosynthesis of secondary metabolites
bbg01120  Microbial metabolism in diverse environments
bbg01130  Biosynthesis of antibiotics
bbg01200  Carbon metabolism
Module
bbg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BGIGA_127 (fbp)
   00030 Pentose phosphate pathway
    BGIGA_127 (fbp)
   00051 Fructose and mannose metabolism
    BGIGA_127 (fbp)
  09102 Energy metabolism
   00680 Methane metabolism
    BGIGA_127 (fbp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbg04147]
    BGIGA_127 (fbp)
Enzymes [BR:bbg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BGIGA_127 (fbp)
Exosome [BR:bbg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BGIGA_127 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase Inositol_P Methyltransf_9 tRNA_NucTransf2
Motif
Other DBs
NCBI-ProteinID: AFJ90579
UniProt: I3QG44
Position
complement(138793..139788)
Genome map
AA seq 331 aa AA seqDB search
MCTLGEFIIKNRDRFSYSTEALLRLFSSIKLASKAIHKEVNKAGLTEKIIGSSGITNVQG
ENQKKLDNFAHKAFIESFKSRNVVCGIASEESKDFIVIKEKQENIFQNQYIVLIDPLDGS
SNIDVNVSIGTIFSVYMRKSPIQMNLTIEDFLQKGNKQILAGYIIYGSSTILVYSTGNGV
HEFTLDPSVGTFYLSHFNLCFPKKEKIYSINEGNYAKFSNGIRKFIRYCQEKKPPYTARY
IGSLVGDFHRNMIQGGIYIYPETASYPEGKLRLLYECNPMAFLAEQAGGKASDGKKRILD
IEPTKLHQRTPFVCGPLGMVSKLEKFMIDYE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtgcacattaggagaatttattataaaaaatagagatcgtttttcatattcaacagaa
gcattgttgcgattgtttagctctataaaattggcttctaaagcaattcataaagaagtc
aataaagcaggattaacagaaaaaataataggaagttccggtattactaatgttcaagga
gaaaatcaaaaaaaattggacaattttgctcataaagcttttattgaatcttttaaaagt
agaaatgttgtttgtggaattgcttctgaagaaagtaaagattttatagtaattaaagaa
aaacaagaaaatatttttcaaaatcaatacattgttttaatagatccacttgatggttca
tctaatatagatgtgaatgtatctattgggactatattttctgtatatatgagaaaatct
cctattcaaatgaatttaacaatagaagattttttgcaaaaaggaaataaacaaattctt
gcaggatatattatttatggatcttctactatattagtatatagtactggtaatggagta
catgaatttactttagacccttcagttggaacattttacttatctcattttaatctttgt
tttcctaaaaaagaaaaaatttattctattaatgaaggaaattatgctaaattctctaat
ggaattagaaaatttattagatattgtcaagaaaaaaaacctccctacacagcaagatat
attggatctttagtgggagattttcacagaaacatgatacaaggaggaatatatatttat
cccgaaacagcttcttatccggaaggaaaattgagattactttatgaatgtaatcctatg
gcttttttagcagaacaagctggaggaaaagcttctgatggaaaaaaacggattctagat
atagaacctactaaattacatcaaagaactccatttgtttgtggtccattggggatggtt
tccaagttagaaaaatttatgatagattatgaataa

DBGET integrated database retrieval system