KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_137Help
Entry
BGIGA_137         CDS       T02109                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
bbg00260  Glycine, serine and threonine metabolism
bbg00750  Vitamin B6 metabolism
bbg01100  Metabolic pathways
bbg01110  Biosynthesis of secondary metabolites
bbg01120  Microbial metabolism in diverse environments
bbg01230  Biosynthesis of amino acids
Module
bbg_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BGIGA_137 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BGIGA_137 (thrC)
Enzymes [BR:bbg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BGIGA_137 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFJ90588
UniProt: I3QG53
Position
148532..149854
Genome map
AA seq 440 aa AA seqDB search
MLYYSLKNYKNLVSFEDAVLTGLSPDGGLYMPKWIPKLEPKFIRKLPIYDIYTIAMFVIK
PYIGKYIPEKFINNIIHDTLNFSFPLKKIHDNIYVLELFHGPTLAFKDVGAKFMAGCLSF
FSEKLEKNVTVLVATSGDTGGAVAKGFHKKPGIEVIILYPYNGISSLQEKQITSLGDNIL
ALEIHGNFDDCQNMVKKAFLDKEVNKKYSLTSANSINVGRWLPQMFYYFLAYRQIIIKNP
IELIFSVPSGNFGNLCAGMIAEKMGLPIKFFIASTNINDTIPRFLKSEKYHPFPVQKTIS
NAMDISDPSNFSRIWHLYQKNIFQLRKKLSSYKFTDEETLSVIEMIWKKYKYMLDPHGAI
GYLGLRQYLQEVNITSLEPGIFLETAHPIKFFDHMPLFLQKEIIPTQEVEIFLNTKKSKN
KKISLSNDFNVFKNWLLERK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgttgtattatagtttgaaaaattataaaaacttagtttcttttgaagatgctgtttta
acaggtttatcacctgatggaggattatatatgcctaaatggattcctaaattagaacct
aaatttattcggaaacttccaatttatgatatttatacaattgccatgttcgtaataaag
ccttatattggaaaatatattcctgaaaaatttattaataatattattcatgatactttg
aatttttcttttccattaaaaaaaatacatgataatatttatgtattagagctttttcat
ggacctactttagcttttaaagatgtaggagcaaaatttatggcaggatgcttaagtttt
ttttctgaaaaattagaaaaaaatgtaacggttttagttgcaacttcaggagataccgga
ggtgcagttgctaaaggatttcataaaaaacctggaatagaagttattattttgtatcca
tataatggaattagttctttacaagaaaaacaaatcacttctttaggagataatatatta
gcattggaaatccatggaaattttgacgattgtcaaaatatggttaaaaaagctttttta
gacaaagaagtaaataaaaaatattcattaacttctgccaattctataaatgtaggaaga
tggcttcctcaaatgttttattattttttagcttatagacaaatcataataaaaaatccg
atagaattaattttttcagttcctagtggtaattttggaaatctttgtgcgggaatgata
gctgaaaaaatgggtttacctataaaattttttattgcatctacaaatattaatgatact
attcctagatttttaaaatctgaaaaatatcatccttttcccgtacaaaaaactatatca
aatgctatggatatatctgatcccagtaatttttctagaatatggcatttatatcaaaaa
aatatatttcaattaagaaaaaaactatcttcctataaattcacggatgaagaaacttta
tcagttatagaaatgatatggaaaaaatataaatacatgttagatccacatggggctatt
ggttatttaggccttagacaatatttacaagaagtgaatatcacttctttagaaccaggt
atttttttagaaacagctcatcccattaaattttttgatcatatgccacttttcttacaa
aaagaaatcattcctactcaagaagtagaaatatttttgaatacaaaaaaaagtaaaaac
aaaaaaatatcattatccaatgattttaatgttttcaaaaattggttattagaaagaaaa
taa

DBGET integrated database retrieval system