KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_336Help
Entry
BGIGA_336         CDS       T02109                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
bbg00230  Purine metabolism
bbg01100  Metabolic pathways
Module
bbg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BGIGA_336 (gmk)
Enzymes [BR:bbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BGIGA_336 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 T2SSE AAA_22 TsaE ABC_tran AAA_33 AAA_29 RsgA_GTPase Zeta_toxin AAA_5 CbiA AAA_16 Mg_chelatase RNA_helicase SRPRB CPT AAA NTPase_1 APS_kinase PRK AAA_24 NACHT AAA_25 cobW NB-ARC MobB AAA_30
Motif
Other DBs
NCBI-ProteinID: AFJ90776
UniProt: I3QGP1
Position
364595..365209
Genome map
AA seq 204 aa AA seqDB search
MILNKTKLGKIMKKGKMIILSGPSGSGKTTISHYLLSKFPELKFSVSCTTRSIRNNEIHG
KDYYFLSVNSFIYKIKKCQFAEWEEVYPNLFYGTLKNEISKIWKSNQHILFDIDVKGGLN
LKKKYPNNSLSIFVTVNSINILKKRLIARCYKNNTNINTRLNKVQEENSYAKLFDFILFN
IDLYQTKKKAIQIVSNFIYGKQSE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatattaaacaaaacaaagttaggcaaaataatgaaaaaaggaaaaatgattattctg
tcaggcccttctggatctggaaaaacaaccatttcgcattatttactttcaaaatttccg
gaattaaaattttctgtttcatgcacaacgcgatcaattcggaataatgaaatacatgga
aaagattattattttttatctgtaaactcttttatttataaaataaaaaaatgccaattt
gcagagtgggaagaagtttatccaaacttattttatggaaccttaaaaaacgaaatttcc
aaaatttggaaatctaatcaacatattttatttgatatagatgtaaaaggaggattaaat
ttaaaaaaaaaatacccaaataattctttatccatatttgtaacagtaaattctataaat
attttaaaaaaaagacttattgcaagatgttataaaaataatacgaacatcaacactcgt
ttaaataaggttcaagaagaaaatagttatgctaaattgtttgactttattttattcaat
attgatttgtatcaaactaaaaaaaaagcgattcaaatagtttccaattttatttatgga
aaacaatcggagtga

DBGET integrated database retrieval system