KEGG   Bordetella bronchiseptica 253: BN112_1604Help
Entry
BN112_1604        CDS       T02344                                 

Definition
(RefSeq) geranyltranstransferase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00900  Terpenoid backbone biosynthesis
bbh01100  Metabolic pathways
bbh01110  Biosynthesis of secondary metabolites
bbh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbh00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN112_1604
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bbh01006]
    BN112_1604
Enzymes [BR:bbh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BN112_1604
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BN112_1604
Prenyltransferases [BR:bbh01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BN112_1604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 13978662
NCBI-ProteinID: YP_006967672
UniProt: A0A0C6P5I6
Position
complement(1723848..1724759)
Genome map
AA seq 303 aa AA seqDB search
MKQSHLACADWLRERAQHVEHVLDELLPGADIAPTRLHEAMRYAVLGGGKRVRAALVYAA
GQACPVNGSTLAVGASMDRAAAAVELIHAYSLVHDDLPCMDDDTLRRGRPTVHVQFDEAT
AMLAGDALQPLAFELLAGMPIAPALVVQAAQVLARAAGSQGMAGGQAIDLHSVGRMLTRD
ELQTMHSMKTGAMLACSVTLGGIVAGASSTARQALDSYAQAIGLAFQVVDDILDVTADTA
SLGKTAGKDAADNKPTYVSLLGLDQARALAQELRQAAHQALAPLGESGARLGQLADFIVL
RDR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaagtcatctcgcctgcgccgactggctgcgggaacgcgcgcagcatgtcgag
cacgtgctcgacgaattgctgcctggcgccgatatcgctcccacgcggctgcacgaagcc
atgcgctatgcggtgctgggcggcggcaagcgggtgcgcgcggccctggtctacgcggcc
gggcaggcctgccccgtcaacggcagcacgctggccgtcggggcgtcgatggaccgcgcc
gccgcggccgtcgaactgatccacgcctattcgctggtgcacgacgacctgccgtgcatg
gacgacgacacgctgcgccgcggccggcccacggtgcatgtgcaattcgacgaggccacg
gccatgctggccggcgatgccctgcagccgctggccttcgaactgctggccggcatgccg
atcgcgcccgcgctggtggtgcaggccgcccaggtcctggcgcgcgccgccggcagccag
ggcatggccggcgggcaggccatcgacctgcacagcgtgggccgcatgctcacgcgcgac
gaactgcagaccatgcacagcatgaagaccggcgccatgctggcgtgcagcgtgacgctg
gggggcatcgtggccggcgccagctcgaccgcgcgccaggcgctcgacagctacgcgcag
gcgatcggcctggcgttccaggtcgtcgacgatatcctcgatgtgacggccgacaccgcc
agcctgggcaagacggccggcaaggatgcggccgacaacaagccgacctatgtatccttg
ctgggcctggaccaggcccgcgcgctggcgcaggagttgcgccaggcggcccaccaggcc
ctggcgccgctgggcgagtccggcgcgcggctgggccaactggcagatttcatcgtactc
agagaccgctga

DBGET integrated database retrieval system