KEGG   Bordetella bronchiseptica 253: BN112_2557Help
Entry
BN112_2557        CDS       T02344                                 

Gene name
pgm
Definition
(RefSeq) phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00010  Glycolysis / Gluconeogenesis
bbh00030  Pentose phosphate pathway
bbh00051  Fructose and mannose metabolism
bbh00052  Galactose metabolism
bbh00230  Purine metabolism
bbh00500  Starch and sucrose metabolism
bbh00520  Amino sugar and nucleotide sugar metabolism
bbh00521  Streptomycin biosynthesis
bbh01100  Metabolic pathways
bbh01110  Biosynthesis of secondary metabolites
bbh01120  Microbial metabolism in diverse environments
bbh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN112_2557 (pgm)
   00030 Pentose phosphate pathway
    BN112_2557 (pgm)
   00051 Fructose and mannose metabolism
    BN112_2557 (pgm)
   00052 Galactose metabolism
    BN112_2557 (pgm)
   00500 Starch and sucrose metabolism
    BN112_2557 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    BN112_2557 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    BN112_2557 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN112_2557 (pgm)
Enzymes [BR:bbh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BN112_2557 (pgm)
    5.4.2.8  phosphomannomutase
     BN112_2557 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 13979615
NCBI-ProteinID: YP_006968611
UniProt: A0A0C6P8M5
Position
2761286..2762668
Genome map
AA seq 460 aa AA seqDB search
MAHPFPASVYKAYDIRGSVPDQLDPVFARALGRALAASARAQGIGALVVGRDGRLSSPDL
AGALQEGIMEGGVDTLDIGQVPTPLVYFAAHTQGTGSGVAVTGSHNPPQYNGFKMMMGGQ
ALYGPAVQALRPAMLAPAAAPGTWGERRQLDVVPAYIERIVSDVKLARPMKIAVDCGNGV
AGALAPQLFRALGCEVDELYCEVDGTFPNHHPDPAEPRNLQDLIAHVTSTDCELGLAFDG
DGDRLGVVTKSGQIIWPDRQLILFARDVLARCPGATIIYDVKCSRHVGVAIEQSGGVPLM
WQTGHSLVKAKLAETGAPLAGEMSGHIFFKERWYGFDDGLYTGARLLEIVSRETDASRPL
EALPQALSTPELKLEMAEGEPHALIAALQQQGEFASASRLVTIDGVRAEYPDGFGLARAS
NTTPVVVLRFEAETEPGLARIQQEFRQQLLRLAPQAKLPF
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcacccctttcccgcatcggtctacaaggcgtacgacatccgtggctcggttccc
gaccagctcgacccggtattcgcccgggcgctgggccgtgccctggccgccagcgcccgc
gcgcagggcatcggcgccctggtggtcggccgcgacggccgcctgagcagccccgacctg
gccggcgcgctgcaggaaggcatcatggaaggcggtgtggataccctggatatcggccag
gtgcccacgccgctggtctatttcgcggcgcacacccagggcacgggctcgggcgtggcg
gtcaccggcagccacaacccgccgcagtacaacggcttcaagatgatgatgggcggccag
gccctgtacggcccggccgtgcaggcgctgcgcccggccatgctggcgccggctgcggcg
ccgggcacctggggcgaacgccgccagctcgatgtcgtccccgcctatatcgagcgcatc
gtgtcggacgtgaagctggcgcgccccatgaagatcgccgtcgactgcggcaatggcgtg
gccggcgccctggcgccgcaattgttccgcgcgctgggctgcgaagtggacgaactctat
tgcgaggtcgacggcacgtttcccaaccaccatcccgacccggccgaaccgcgcaacctg
caggacctgatcgcccatgtcaccagcaccgactgcgagctgggcctggccttcgacggc
gacggcgaccgcctgggcgtggtgaccaagtccggccagatcatctggcccgaccgccag
ctgatcctgttcgcccgcgacgtgctggcccgctgccccggcgcgaccatcatctatgac
gtcaagtgcagccggcacgtgggcgtggccatcgagcaaagcggcggcgtgccgctgatg
tggcagaccggccattcgctggtgaaggccaagctggccgagaccggcgcgccgctggcc
ggcgagatgagcggccatatcttcttcaaggagcgctggtacggcttcgacgacggcctg
tacaccggcgcccgcctgctggaaatcgtctcccgcgaaaccgatgcgtcgcgcccgctg
gaggccctgccgcaggcgctgtcgacccccgagctcaagctggaaatggccgagggcgag
ccgcatgcgctgatcgccgccctgcagcagcagggcgagttcgccagcgccagccggctg
gttacgatagacggcgtgcgcgcggaatacccggacggcttcgggctggcgcgcgcctcc
aataccacccccgtcgtcgtgctgcgcttcgaggcggagaccgagccgggcctggcccgc
atccagcaggaattccgccagcagctgctgcggctggctccgcaagccaaactgcccttc
tga

DBGET integrated database retrieval system