KEGG   Bordetella bronchiseptica 253: BN112_2624
Entry
BN112_2624        CDS       T02344                                 

Definition
(RefSeq) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BN112_2624
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbh02044]
    BN112_2624
Secretion system [BR:bbh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BN112_2624
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C AAA_28
Other DBs
NCBI-GeneID: 13979682
NCBI-ProteinID: YP_006968676
UniProt: A0A0C6P3Z8
Position
complement(2841413..2845018)
AA seq 1201 aa
MIPRLFGWLFSRGLWSFLGLVALALLVWIAGPLLAIGALRPLESETARVLVIAALFAFAL
LRLLWRKWREGRLNAQLLGQLRRPARPEAEAAAEPPPSDLRELEGRFDEAVELLRKTRFD
GGGGRGWLQRYSRQYLYQLPWYVIIGAPGSGKTTALVNSGLDFPLAERFGKAALRGVGGT
RNCDWWFTDDAVLLDTAGRYTTHESDPTGDEESWRGFLGLLTRFRGRQPINGAMLTVSIE
DLLAASDAERARHAAVLRRRLQELREQLGIHFPVYVLVTKADLLAGFEQYFASFSREDLE
QVWGFTLPYARAQEPDFDLYEAFHAEYRLLQRRLDDALPEVLAAEPDEARRALAYLLPQQ
FAGLQAVLGHFLSDVFASSRFEERLVPRGVYFTSGTQGGETFDQVTGHLKRYLRIESGPA
PAAAEEGRSFFLKRLLQDVIFPEAGLAGRNLRWERRYRRLHWAGYGLITLAFLGLAAGWL
ASYGNNVRYLDEVARRVPTVDKLGRDIKITRSGDVLGLMPFLDGLWYLPRDAAFEPDAPP
LSYRFGLYQGGKMHAAMQGVYRGTLDSVLLPQVARRIEAALRAARADDLEYGYEALRAYL
MLYEADHYDAEFMHAWLLSDMQGTLPEGYTRRQYDLMSLHLRQLAQGGVLASPFPRDEAL
VRQARDELARHTLAQRAYSRLRRMLAGADDQPPTTAVTLGGPQASAVFVRKSGKPLAQGI
AALYTYRGYWDVFNPRVTRVAERLRSDDAWVLDIAPPGVLDEAARQQLIVDIKRLYLNDY
VARWDGYLDDLALAPRSSLLQSIQLARTLSAPDSPLVRLTQGVARETTLLRDAGGDERSL
ADQARDRVSSTREALEQMFGPTGPGAATRADAGDGKLERVVDQHFEPWRRLARADGQGGA
PIAATTSLVNELYTYLTAADAALRSASPAPASDVVTKLRAEAGRLPRPLRDVLDDLSTGA
AGEVSGVARERLGEDLYATIGLFCRQAIAGRYPFAPGSPRDVAPNDLARLFAPNGMMDEF
FQKNLVSQIDVSEARWRFKPGMDGTPGQASALLDSFQRAAAIRDAYFMAGSAEPAFRVSI
RPVEMDPAITQFVMDVDGQTVRYAHGPQVATSVQWPGPRGANQVRIELTPQAGAAGLSAS
GPWALNRLLDQARVTRGASPEISLASFDIGGRKVVLEIRAGSVRSPFHLAEMRGFSCPGR
S
NT seq 3606 nt   +upstreamnt  +downstreamnt
atgatcccgcgcctgttcggatggctgttctcgcgcggcctgtggagcttcctgggcctg
gtggcgctggccctgctggtgtggatcgccgggccgctgctggcgatcggcgcgctgcgc
ccgctggaaagcgagaccgcgcgcgtactggtcatcgccgcgctgttcgccttcgcgctg
ctgcgcctgctgtggcgcaagtggcgcgaaggccgcctcaacgcccagctgctgggccag
ctgcgccggccggcccgtcccgaggccgaggccgcggccgagccgccgccttcggacctg
cgcgaactggaaggccgtttcgacgaggcggtggagctgttgcgcaagacgcgcttcgac
ggaggcggcgggcgcggctggctgcagcgctattcgcgccaatacctgtaccagctgccc
tggtacgtcatcatcggcgcgccaggctcgggcaagaccacggccctggtcaactcgggc
ctggacttcccgctggccgagcgcttcggcaaggccgcgctgcgcggcgtgggcggcacc
cgcaactgcgattggtggttcaccgacgacgcggtgctgctcgataccgccggccgctac
accacccatgaaagcgaccccaccggcgacgaggagtcctggcgcggctttctcggcctg
ttgacgcgctttcggggccgccagcccatcaacggcgccatgctcaccgtcagcatcgag
gacttgctggccgcgtccgacgccgagcgcgcgcgccacgccgcggtgctgcgccggcgc
ctgcaggagctgcgcgagcagctgggcatccatttcccggtctatgtgctggtgaccaag
gccgacctgctggccggcttcgagcagtacttcgcctcgttcagccgcgaagacctggag
caggtatggggcttcaccttgccctatgcgcgcgcccaggagccggacttcgacctgtac
gaagcctttcatgccgagtaccggctgctgcagcgccggctcgacgatgccctgcccgaa
gtgctggccgccgagccggacgaggcgcgccgcgcgctggcctacctgctgccgcagcag
ttcgccggcctgcaggccgtgctgggccatttcctcagcgacgtgttcgccagctcgcgc
ttcgaggagcgcctggtgccgcgcggcgtgtacttcaccagcggcacccagggcggcgag
accttcgaccaggtcaccggccacctcaagcgctatctgcgcatcgaaagcgggccggcc
ccggccgccgccgaggaaggccgcagcttcttcctcaagcggctgctgcaggacgtgatc
tttcccgaggccggcctggccggccgcaacctgcgctgggagcgccgctaccgccgcctg
cactgggccggctacggcctgatcacgctggcgttcctgggcctggcggcgggctggctg
gccagctacggcaacaacgtgcgctatctcgacgaagtggcgcgccgcgtgccgacggtg
gacaagctggggcgcgatatcaagatcacccgctcgggcgatgtgctgggcctgatgccc
ttcctggacggcctgtggtacctgccgcgcgacgccgccttcgagccggacgcgccgccg
ctgtcctatcgcttcgggctgtaccagggcggcaagatgcacgccgcgatgcagggcgtt
tatcgcggcacgctcgacagcgtcctgctgccgcaggtggcgcgccgcatcgaggcggcg
ctgcgcgcggcccgcgccgacgacctggagtacggctacgaggccctgcgcgcctacctg
atgctgtacgaggccgaccactacgacgccgagttcatgcacgcctggctgctgtccgac
atgcagggcacgctgcccgagggctacacgcgccggcagtacgacctgatgtcgctgcac
ctgcgccagctggcgcagggcggcgtgctggcctcgccgtttccgcgcgacgaggcgctg
gtgcggcaggcgcgcgacgaactggcgcgccacacgctggcgcagcgcgcctacagccgg
ctgcgccgcatgctggccggcgccgacgatcagccgccgaccaccgcggtgacgctgggc
gggccgcaggccagcgccgtcttcgtgcgcaagagcggcaagccgctggcccagggcatc
gcggcgctgtacacctaccgcggctattgggacgtgttcaatccgcgcgtcacgcgcgtg
gccgagcgcctgcgcagcgacgatgcctgggtcctggacatcgcgccgccgggcgtgctc
gacgaggccgcgcgccagcagctcatcgtcgacatcaagcgcctgtacctcaacgactac
gtggcgcgctgggacggctacctggacgacctggcgctggcgccgcgcagctcgctgctg
caaagcatccagctggcgcgcaccctgtcggcgcccgattcgccgctggtgcggctgacc
cagggcgtggcgcgcgagaccacgctgctgcgcgacgcgggcggcgacgagcgctcgctg
gcggaccaggcgcgcgaccgcgtcagcagcacgcgcgaggcgctggagcagatgttcggc
ccgaccggcccgggcgcggccacgcgcgccgacgccggcgacggcaagctggagcgcgtg
gtcgaccagcacttcgagccatggcgcaggctggcgcgcgccgacgggcagggcggcgcg
ccgattgccgccaccaccagcctggtcaacgagctgtacacctatctgacggcggccgac
gcggctctgcgcagcgccagcccggcgcccgcctccgatgtggtgaccaagctgcgcgcc
gaggctggccgcctgccgcggcccttgcgcgacgtgctcgacgacttgtccaccggcgcg
gcgggcgaagtgtccggcgtggcgcgcgagcggctgggcgaagacctgtacgccaccatc
ggtctgttctgccgccaggccatcgccggccgctatcctttcgcgcccggctcgccgcgc
gacgtcgcgcccaatgacctggcgcggctgttcgcgcccaacggcatgatggacgagttc
ttccagaagaacctggtcagccagatcgatgtgtccgaggcgcgctggcgcttcaagccg
ggcatggacggcacgccgggccaggcgtcggcgctgctggattcgttccagcgcgccgcc
gcgatccgcgacgcctatttcatggccggcagcgcggagccggcctttcgcgtctcgatc
cgtccggtggaaatggacccggccatcacgcaattcgtcatggacgtggacggccagacc
gtgcgctatgcgcatggcccgcaggtcgccacctccgtgcaatggccggggccgcgcggc
gccaaccaggtgcgcatcgagctgacgccccaggccggcgcggcgggcctgtcggccagc
ggaccgtgggcgctcaatcgcctgctcgaccaggcccgcgtcacgcgcggcgcctcgccc
gagatctcgctggccagcttcgatatcggcggccgcaaagtggtgctggagattcgcgcg
ggcagcgtcaggagcccctttcacctggccgagatgcggggtttttcctgcccgggccgt
tcatga

DBGET integrated database retrieval system