KEGG   Bordetella bronchiseptica 253: BN112_2626Help
Entry
BN112_2626        CDS       T02344                                 

Definition
(RefSeq) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
bbh  Bordetella bronchiseptica 253
Brite
KEGG Orthology (KO) [BR:bbh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbh02044]
    BN112_2626
Secretion system [BR:bbh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BN112_2626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-GeneID: 13979684
NCBI-ProteinID: YP_006968678
UniProt: A0A0C6P852
Position
complement(2846316..2847650)
Genome map
AA seq 444 aa AA seqDB search
MALDNKVVWSEGMFLRPQHFQQFERHIEAQLRVRAAAASGCGWGYTALEIDRDALALGKL
ALARAAGVLPDGTPFEFERADEGPPALDIDPAMRDARVMLALPRRRAGACEVVYEDGADT
LARYCVHEGEIEDSGSVGLEPALVQLGRLRLRLVPETELGDEWVALGAARVLERRADHRV
VLDEMYIPPWLAADANPALRGYAGELSGLLQARAAALAQRLAQPGRGGVSEVADFLLLAL
VNRYAGALWHARQVPALHPERLFRDWLMLACDLATYTCATRLPEVLPDYRHDDLQASFGP
LMAELRRSLSVVLEQHAVQIPLHDRGQGVRVAQIADAELLRSAGFVLAVHADMPAETVRT
RFPAQVKIGPVERIRDLVHLQLPGVAVRALPVAPRQIPYSAGHVYFELDKNGEFWRQLER
TGALALHLAGEFPGLALEFWAVRD
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcactggacaacaaggtcgtctggtcggagggcatgttcctgcggccgcaacatttc
cagcagttcgaacggcatatcgaggcgcagttgcgcgtgcgcgccgcggcggcctcgggc
tgcggctggggctacaccgcgctggagatcgatcgcgacgcgctggcgctgggcaagctg
gcgctggcgcgcgccgcgggcgtgctgcccgacggcacgccgttcgagttcgagcgcgcc
gacgaggggccgccggcgctggacatcgacccggccatgcgcgatgcgcgcgtgatgctg
gcgctgccgcgccgccgcgccggcgcctgcgaagtggtctacgaagacggcgcggatacg
ctggcgcgctattgcgtgcatgaaggcgagatcgaggactccggctcggtgggcctggag
ccggcgctggtgcagctgggccgtttgcgcctgcggctggttcccgaaaccgagctgggc
gacgaatgggtggcgctgggcgccgcgcgggtgctggagcgccgcgccgaccaccgcgtg
gtgctcgacgagatgtacatcccgccctggctggccgccgacgccaatccggcgctgcgc
ggctatgccggcgagctgtccgggctgctgcaggcgcgcgcagcggcgctggcgcagcgg
ctggcgcagccgggccgcggcggcgtctccgaagtggccgacttcctgctgctggcgctg
gtaaaccgctacgccggcgcgctgtggcacgcgcgccaggtgccggccctgcatcccgaa
cggctgtttcgcgactggctgatgctggcctgcgacctggccacctatacctgcgccacg
cgcctgcccgaggtgctgcccgattaccgccacgacgacctgcaggccagtttcgggccg
ctcatggccgagctgcgccgctcgctgtcggtggtgctggagcagcacgccgtgcagatc
ccgctgcatgaccgcggccagggcgtgcgcgtggcgcagatcgccgatgccgaactgctg
cgcagcgccggcttcgtgctggccgtgcacgccgacatgccggccgagacggtgcgcacg
cgctttccggcccaggtcaagatcggcccggtcgagcgcatccgcgacctggtgcatctg
caattgcccggcgtggcggtgcgcgccctgccggtggcgccgcgccagattccctacagc
gcgggccacgtgtacttcgagctggacaagaacggcgagttctggcggcagctggagcgc
accggcgcgctggccctgcacctggcgggcgagtttcccggcctggcgctggagttctgg
gccgtgcgcgactga

DBGET integrated database retrieval system