KEGG   Bordetella bronchiseptica 253: BN112_2627
Entry
BN112_2627        CDS       T02344                                 

Definition
(RefSeq) lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BN112_2627
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbh02044]
    BN112_2627
Secretion system [BR:bbh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BN112_2627
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-GeneID: 13979685
NCBI-ProteinID: YP_006968679
UniProt: A0A0C6P8U8
Position
complement(2847696..2848238)
AA seq 180 aa
MLVAVPTRRALRAAAWIAVAVLAAGCASTASRKAAPYAIELKADPRVNPDASGRPSPIQV
TLYELRSSAEFEARDFFTLQGDAQAALGKSLIETDQVILQPGETRKLSYPGNTEARVVGI
VAAYRDLERSPWRIVVPLPQAQNTNIYKFWQFSPNEETVRVAVGGQGVQIVDRERSWWPF
NT seq 543 nt   +upstreamnt  +downstreamnt
ttgcttgttgctgtgcccacgcggcgcgcgttgcgcgcggcggcctggattgccgtcgcg
gtgctggccgccgggtgcgcgtccacggccagccgcaaggcggcgccttacgcgatcgag
ctgaaggccgatccgcgcgtcaatcccgatgcctcgggccggccctcgccgatccaggtc
acgctgtacgagctgcgttcgtccgccgagttcgaggcgcgcgatttcttcaccctgcaa
ggcgacgcgcaggccgcgctgggcaagtcgctcatcgaaaccgaccaggtcatcctgcag
cccggcgaaacccgcaagctgtcgtatccgggcaataccgaggcgcgcgtggtcggcatc
gtggcggcctatcgcgacctcgagcgcagtccctggcgcatcgtcgtgcccctgccgcag
gcccagaacaccaacatctacaagttctggcagttctcgcccaacgaggagaccgtgcgc
gtcgcggtgggcggacagggcgtgcaaatcgtcgaccgggagcgttcctggtggcccttc
tga

DBGET integrated database retrieval system