KEGG   Bordetella bronchiseptica 253: BN112_2629
Entry
BN112_2629        CDS       T02344                                 

Definition
(RefSeq) hypothetical protein
  KO
K07169  FHA domain-containing protein
Organism
bbh  Bordetella bronchiseptica 253
Brite
KEGG Orthology (KO) [BR:bbh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    BN112_2629
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-GeneID: 13979687
NCBI-ProteinID: YP_006968681
UniProt: A0A0C6P405
Position
2848926..2849726
AA seq 266 aa
MMLTLIVRNPEPGASARRADFHAPGGTLGRDAENCLALPAAPGQLCRVQAALRADAQGWR
LHNLSGMAAVHINDAALAPGAVRAIQAGDTLRVGAHTLEVSGPDAPDARPAALPEAAADT
PADAPRRGQAGAGAAEDIFSGLFGPGTLPVGGTADAATHPFDLDSAQARNAADPLAHLPA
GDAAVSRPAGDPLALFDAPHGGADVFADATPSALPAHDPLAPLRADPVRDTLLPRHAAGD
GPAAHDHAPAGGTFLRPAAPRADQAD
NT seq 801 nt   +upstreamnt  +downstreamnt
atgatgctgacgctgatcgtacgcaaccccgagcctggcgcaagcgcgcgccgggcggat
ttccacgcgcccggcggcacgctgggccgcgacgccgagaattgcctggccctgccggcc
gcgcccggccagctatgccgcgtgcaggccgcgctgcgcgccgacgcgcaaggctggcgc
ctgcacaacctgagcggcatggccgcggtgcacatcaacgacgcggcgctcgcgcccggc
gccgtgcgcgccatccaggcgggcgatacgctgcgcgtgggcgcgcacacgctggaggtg
agcgggcccgatgcgcccgacgcacggccggcagcactgcccgaggcggcggcggacacg
cccgccgatgcgccccggcgcgggcaagccggcgccggggcggccgaggacatattcagc
ggcctgttcggccccggcaccctgccggtgggcggcaccgccgatgctgccacgcacccc
ttcgacctggattcggcgcaggcgcgcaacgccgccgatccgctggcgcatctgccggcc
ggcgacgccgcggtcagccgcccggcgggcgacccgctggcgctgttcgacgcgccgcat
ggcggcgcggacgtgttcgccgacgccaccccgtcggccctgcccgcgcacgatccgctg
gcgccgctgcgcgccgacccggtgcgcgacacgctgctgccgcgccacgcggccggcgac
ggcccggccgcgcacgaccatgcgccggcgggaggcaccttcctgcgcccggccgcgccg
cgcgcggaccaggcggactga

DBGET integrated database retrieval system