KEGG   Bordetella bronchiseptica 253: BN112_2636
Entry
BN112_2636        CDS       T02344                                 

Definition
(RefSeq) hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bbh  Bordetella bronchiseptica 253
Brite
KEGG Orthology (KO) [BR:bbh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbh02044]
    BN112_2636
Secretion system [BR:bbh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BN112_2636
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-GeneID: 13979694
NCBI-ProteinID: YP_006968688
UniProt: A0A0C6P870
Position
complement(2857010..2857528)
AA seq 172 aa
MRIADERVARDRLQPSLLDRLVDDEPWRRSEAPEAALLTYAGLRAAVLRDLRWLLNTVNL
ASSQDLAPYRHVPASSVNFGVRAMAGRRMSEIDWVDVETSIRDAIAAFEPRILESSVEVR
CVSDTRTLEHHNVLSLEIRGMLWCVPHPREFLFRTDIDLESGHMDLRDLGGA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgagaatcgccgacgaacgggtggcgcgcgaccgcctgcagccgtcgctgctcgatcgc
ctggtcgatgacgagccatggcgccgcagcgaggcgcccgaagcggcgctgttgacgtac
gccgggctgcgcgccgcggtactgcgcgacctgcgctggctgctcaacacggtcaacctc
gcctcgtcgcaggatctggcgccgtaccggcacgtgcccgcctccagcgtcaatttcggc
gtgcgcgccatggccggacgccgcatgtcggagatcgactgggtcgatgtcgagacgtcg
atccgcgacgccatcgcggcgttcgagccgcgcatcctggaatcctcggttgaggtgcgc
tgcgtcagcgacacccgcacgctcgagcaccacaatgtgctcagcctggaaatacgcggc
atgctgtggtgcgtgccgcacccgcgcgagttcctgttccgcaccgatatcgacctggaa
agcgggcacatggacctgcgcgacctgggaggggcgtga

DBGET integrated database retrieval system