KEGG   Bordetella bronchiseptica 253: BN112_3050Help
Entry
BN112_3050        CDS       T02344                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00071  Fatty acid degradation
bbh00280  Valine, leucine and isoleucine degradation
bbh00281  Geraniol degradation
bbh00310  Lysine degradation
bbh00360  Phenylalanine metabolism
bbh00362  Benzoate degradation
bbh00380  Tryptophan metabolism
bbh00410  beta-Alanine metabolism
bbh00627  Aminobenzoate degradation
bbh00640  Propanoate metabolism
bbh00650  Butanoate metabolism
bbh00903  Limonene and pinene degradation
bbh00930  Caprolactam degradation
bbh01100  Metabolic pathways
bbh01110  Biosynthesis of secondary metabolites
bbh01120  Microbial metabolism in diverse environments
bbh01130  Biosynthesis of antibiotics
bbh01212  Fatty acid metabolism
Module
bbh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN112_3050
   00650 Butanoate metabolism
    BN112_3050
  Lipid metabolism
   00071 Fatty acid degradation
    BN112_3050
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN112_3050
   00310 Lysine degradation
    BN112_3050
   00360 Phenylalanine metabolism
    BN112_3050
   00380 Tryptophan metabolism
    BN112_3050
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN112_3050
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN112_3050
   00281 Geraniol degradation
    BN112_3050
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN112_3050
   00627 Aminobenzoate degradation
    BN112_3050
   00930 Caprolactam degradation
    BN112_3050
Enzymes [BR:bbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN112_3050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 13980108
NCBI-ProteinID: YP_006969098
UniProt: A0A0C6P5Z8
Position
complement(3299761..3300576)
Genome map
AA seq 271 aa AA seqDB search
MTGTERYQNYQVIEFDRPAPRVLRLTLNRPERMNALDSRGHAELADVWRDIDADPDVSAV
VLRGAGRAFSAGGDFSMLEEMNEDFKVRARVWREARDLVYNIVNCSKPIVSAIRGPAVGA
GLVAALLADISVAAKSARIVDGHTKLGVAAGDHAAIIWPLLCGMAKAKYHLMLCEPLNGE
QAEALGLVSLCVEDDALEDKALEIAQRLAAGAPAALRWTKYALNNWLRQAGPIFDTSLAL
EFMGFGSPEAKEGVSALMEKRAPAFDQDIAI
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgactggaaccgagcgctatcagaactatcaggtgatcgaattcgaccgtcccgcgccg
cgcgtgctgcgcctgacgctgaaccggcccgaacgcatgaacgcgctggattcgcgcggc
catgcggagctggccgacgtatggcgcgacatcgatgcggatcccgatgtcagcgccgtg
gtgctgcgcggcgccgggcgcgccttttccgcgggcggcgatttcagcatgctcgaggaa
atgaacgaggacttcaaggtccgggcccgtgtgtggcgcgaggcgcgcgacctggtctac
aacatcgtgaactgttccaagcccatcgtctcggccatccgcggcccggcggtcggcgcg
ggcctggtcgcggccttgctggccgatatctcggtggcggcgaagtcggcccgcatcgtc
gacggccacaccaagctgggcgtggccgcgggcgaccatgccgccatcatctggccgctg
ctgtgcggcatggccaaggccaagtaccacctgatgctgtgcgagccgctcaatggcgaa
caggccgaggccctgggcctggtgtccctgtgcgtcgaggacgacgccctggaggacaag
gcgctggagatcgcgcaacggctggcggccggcgcgccggccgcgttgcgctggaccaag
tacgccctgaacaactggctgcgccaggcgggcccgatcttcgatacgtcgctggcgctc
gagttcatgggctttggcagtccggaggcgaaggagggcgtcagcgccctgatggaaaag
cgcgcgccggcgttcgaccaggacatcgcgatctag

DBGET integrated database retrieval system