KEGG   Bordetella bronchiseptica 253: BN112_3800Help
Entry
BN112_3800        CDS       T02344                                 

Definition
(RefSeq) hypothetical protein
  KO
K06195  ApaG protein
Organism
bbh  Bordetella bronchiseptica 253
Brite
KEGG Orthology (KO) [BR:bbh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BN112_3800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-GeneID: 13980855
NCBI-ProteinID: YP_006969836
UniProt: A0A0C6PBP1
Position
4083652..4084026
Genome map
AA seq 124 aa AA seqDB search
MKPYDLTVSVTPRYVPEQSDPSQQQYVFAYTVRITNTGSHPAQVISRHWIITDGEERVQE
VRGLGVVGQQPLLAPGETFEYTSGCPLPTPIGTMRGTYHCVGENGIPFEVPIAEFLLAMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccctatgatctgaccgtatccgtgaccccgcgttatgtgccggagcagtccgat
cccagtcagcagcaatacgtgtttgcctacacggtgcgcatcaccaataccggttcgcac
ccggcccaggtcatcagccgccactggatcatcaccgacggcgaggagcgcgtgcaggaa
gtgcgcggccttggcgtggtgggccagcaaccgctgctggcgccgggcgagaccttcgaa
tacaccagcggctgtccgcttccgacccccatcggcacgatgcggggtacctaccattgc
gtcggcgaaaacggcattccgttcgaggtgccgatcgcggagttcctgctggccatgccg
cgtacactgcactga

DBGET integrated database retrieval system