KEGG   Bordetella bronchiseptica 253: BN112_4165Help
Entry
BN112_4165        CDS       T02344                                 

Definition
(RefSeq) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00071  Fatty acid degradation
bbh00072  Synthesis and degradation of ketone bodies
bbh00280  Valine, leucine and isoleucine degradation
bbh00310  Lysine degradation
bbh00362  Benzoate degradation
bbh00380  Tryptophan metabolism
bbh00620  Pyruvate metabolism
bbh00630  Glyoxylate and dicarboxylate metabolism
bbh00640  Propanoate metabolism
bbh00650  Butanoate metabolism
bbh00900  Terpenoid backbone biosynthesis
bbh01100  Metabolic pathways
bbh01110  Biosynthesis of secondary metabolites
bbh01120  Microbial metabolism in diverse environments
bbh01130  Biosynthesis of antibiotics
bbh01200  Carbon metabolism
bbh01212  Fatty acid metabolism
bbh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN112_4165
   00630 Glyoxylate and dicarboxylate metabolism
    BN112_4165
   00640 Propanoate metabolism
    BN112_4165
   00650 Butanoate metabolism
    BN112_4165
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN112_4165
   00072 Synthesis and degradation of ketone bodies
    BN112_4165
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN112_4165
   00310 Lysine degradation
    BN112_4165
   00380 Tryptophan metabolism
    BN112_4165
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN112_4165
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN112_4165
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BN112_4165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbh04147]
    BN112_4165
Enzymes [BR:bbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BN112_4165
Exosome [BR:bbh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BN112_4165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 13981220
NCBI-ProteinID: YP_006970200
UniProt: A0A0C6PCJ8
Position
4475286..4476479
Genome map
AA seq 397 aa AA seqDB search
MSVHPDPVVIVAARRTPIGAFQGALAHYSAPQLGAHALAAAVRQAGLQPDAAQEALMGCC
LFAGLGQAPARQAVLGAGLPTDVQATTLSKMCGSGMKAAMLAHDMLRAGSADVVLAGGME
SMSNAPHLIPKARQGYRLGDGQLLDHMYRDGLQDAYEGRLMGHYADLAAREYGFSREQQD
AYAHESVLRAQRSVAEGEFAEEIAPIAGLARRGAPAAMVAVDETPGLCDVSRLASLKPVF
NADGTVTAGNASSISDGAAALVLTRQAHAERLGLAPQARIVGHATAALPPGQFPAAPVRA
IARLFERVGWDRDSVDLFEINEAFAVVTMIALRELGLPAERVNVNGGACALGHPVGATGA
RLIVTLMHALRRRGLRRGVACLCLGGGEATAIAVERA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtccatccagatcccgtagtcatcgtcgcggcgcggcgcacacccatcggcgcg
ttccagggcgcgctggcgcactacagcgcgccgcaactgggcgcccatgcgctggccgcc
gcggtgcggcaggcgggcctgcagcccgacgcggcgcaggaggcgctgatgggatgctgc
ctgttcgccgggctggggcaggcgccggcccgccaggccgtgctcggcgcagggctgcct
accgacgtgcaggccaccaccctgagcaagatgtgcggctcgggcatgaaggccgccatg
ctggcgcatgacatgctgcgcgccggatcggccgatgtggtgctggccggcggcatggag
tcgatgagcaatgcgccgcatctgatccccaaggcgcgccagggatatcggctcggtgac
ggccagttgctcgaccacatgtaccgcgacggcctgcaggatgcctacgaaggccggctg
atggggcattacgccgacctggccgcgcgcgaatacggcttctcccgcgaacagcaggac
gcgtatgcgcacgagagcgtcctgcgggcgcaacgcagcgtcgccgaaggcgaattcgcc
gaggaaatcgcgcccatagccggcctggcgcgccgtggcgcgccggccgccatggtcgct
gtcgacgagacgcccggcctgtgcgacgtgtcgcggctggccagcctcaagccggtcttc
aatgccgacggtacggtgactgccggcaacgcctcttcgatctccgacggcgcggccgcc
ctggtgctgacgcggcaggcgcacgccgagcgcctggggctggctccccaggcgcgcatc
gtcggccatgccaccgcggcgctgccaccgggccagtttccggccgcgcccgtgcgcgcc
atcgcgcggctgttcgagcgggtgggctgggaccgcgactcggtcgacctgttcgagatc
aacgaggctttcgcggtcgtgacgatgatcgccttgcgcgaactgggcctgccggccgaa
cgggtcaatgtcaacggcggcgcctgcgccttggggcatccggtcggcgccacgggcgcg
cgcctgatcgtcacgctgatgcacgcgctgcggcggcgcggcctgcgtcgcggcgtggcc
tgcctgtgcctgggcggcggcgaagcgacggcgatcgccgtcgagcgcgcctga

DBGET integrated database retrieval system