KEGG   Bordetella bronchiseptica 253: BN112_4339Help
Entry
BN112_4339        CDS       T02344                                 

Gene name
folK
Definition
(RefSeq) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00790  Folate biosynthesis
bbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BN112_4339 (folK)
Enzymes [BR:bbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BN112_4339 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-GeneID: 13981394
NCBI-ProteinID: YP_006970373
UniProt: A0A0C6PCA9
Position
complement(4669507..4669998)
Genome map
AA seq 163 aa AA seqDB search
MSGAPAPVLAYVGLGANLGDAAATLRGVLDELAAAPGVLACTASRLYRTAPVDAQGPDFV
NAVAALSTTLAPLALLDLLQALEQRHGRERPYRNAPRTLDLDLLLYGDDAIDHPRLSVPH
PRMHERAFVLAPLCELAPGLRLAQGDCAALLAALAGQAIEPLR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgccccggctcccgtcctggcgtacgtcggcctgggagccaacctgggcgat
gcggccgcgacactgcgcggcgtgctggacgaactggccgccgcgcccggcgtactcgcc
tgcacggcctcgcgcctgtaccgcacggcgcccgtcgacgcccagggccccgatttcgtc
aacgcggtcgccgcgctcagcactacgctggcgccactggccctgctggatctgttgcag
gcgctggagcagcgccacgggcgcgaacggccctaccgcaatgcgccacgcaccctggac
ctggatctgctgctgtacggcgacgacgccatcgaccatccccgcctgagcgtgccgcat
ccgcgcatgcatgaacgcgccttcgtgctggcgccgctatgcgagctggcgccgggcctg
cgcctggcgcagggcgactgcgcggcgttgctggccgcgctggccggccaggccatcgag
ccgctgcgctga

DBGET integrated database retrieval system