KEGG   Bifidobacterium bifidum S17: BBIF_0253Help
Entry
BBIF_0253         CDS       T01328                                 

Definition
(GenBank) hypothetical protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
bbi00051  Fructose and mannose metabolism
bbi01100  Metabolic pathways
bbi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BBIF_0253
Enzymes [BR:bbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     BBIF_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: ADO52458
UniProt: E3ELR3
Position
295150..295446
Genome map
AA seq 98 aa AA seqDB search
MPPHAGGVGLCEAVRHFAMFDYLAVSGQWDDRVIEYVDNQHEYFVHPTEIVNGRYKAPTT
PGSGVDMKLEAAERYLYKGLIAAPRCRGSHGHEHNKGH
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
gtgccaccccacgccggcggtgtcggcctgtgcgaggcggtgcgtcacttcgccatgttc
gattacctggcggtcagtggacaatgggatgatcgcgtcatcgaatatgtggacaaccag
cacgaatacttcgtgcatcccactgagatcgtcaatggtcgttacaaggccccgaccact
ccgggctcgggcgtcgacatgaaactcgaagccgccgaacggtacctgtacaaggggctg
atcgcagcgccgcggtgccgcggctcgcacggacacgaacacaacaaaggacactga

DBGET integrated database retrieval system