KEGG   Bifidobacterium bifidum S17: BBIF_0700Help
Entry
BBIF_0700         CDS       T01328                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
bbi00010  Glycolysis / Gluconeogenesis
bbi00520  Amino sugar and nucleotide sugar metabolism
bbi01100  Metabolic pathways
bbi01110  Biosynthesis of secondary metabolites
bbi01120  Microbial metabolism in diverse environments
bbi01130  Biosynthesis of antibiotics
bbi01200  Carbon metabolism
Module
bbi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBIF_0700 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    BBIF_0700 (ppgK)
Enzymes [BR:bbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BBIF_0700 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADO52905
UniProt: E3EPY3
Position
856047..856808
Genome map
AA seq 253 aa AA seqDB search
MIDTAQAFGVDIGGSGIKAAPVDLNKGEFAEPRLKILTPSESTPQAIGSVLRKQLEHFEV
PETVPVGISFPAPVKPGQKLNWIANLDQSWVGVDITEALSEECGRPVTVVNDADAAGLAE
QQFGAAKGQEGLVVVTTLGTGIGTALIYDGVLIPNTELGHIELEGGKGDAERYASSAVRE
RKELSYKKWAKRLTKYYSLIEKYFSPSLIVIGGGVSRKSDNFVPFIDIDTPIVPAKLRNE
AGIIGAAYYASTK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgattgataccgctcaagcgtttggcgtggatatcggcggatccggtatcaaggccgct
ccggtcgacctgaacaagggggagttcgccgagcccaggctgaagatcctcaccccgtcc
gagtccaccccgcaggcgatcggatcggtgctgcgcaagcagctcgaacatttcgaggtt
ccggagacggttccggtcggcatctctttccctgctccggtcaagcccggccagaagctg
aattggatcgccaacctcgaccagtcgtgggtaggcgtcgacatcaccgaggcgctgtcc
gaggagtgcggccgtccggtcacggtcgtcaatgacgccgatgccgccggcttggcggaa
cagcagttcggcgcggccaagggtcaggagggtctggtcgtcgtgaccacgctcggtacc
ggcatcggcacggcgctgatctatgacggcgtgctcattccgaacaccgagctcggccac
atcgagctggagggcggcaagggcgacgccgagcgctacgcatcctccgcggtgcgcgag
cgcaaggagctcagctacaagaagtgggccaagcgtctgaccaagtactacagcctgatc
gaaaagtacttcagcccctcgctgatcgtcatcggtggtggcgtgagccgcaagagcgac
aacttcgtgccgttcatcgacatcgatacgccgatcgtccccgcgaagctgcgcaacgag
gccggcatcatcggtgccgcctactacgccagcaccaagtag

DBGET integrated database retrieval system