KEGG   Bifidobacterium bifidum S17: BBIF_0955Help
Entry
BBIF_0955         CDS       T01328                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
bbi00020  Citrate cycle (TCA cycle)
bbi00640  Propanoate metabolism
bbi00660  C5-Branched dibasic acid metabolism
bbi01100  Metabolic pathways
bbi01110  Biosynthesis of secondary metabolites
bbi01120  Microbial metabolism in diverse environments
bbi01130  Biosynthesis of antibiotics
bbi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBIF_0955 (sucC)
   00640 Propanoate metabolism
    BBIF_0955 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BBIF_0955 (sucC)
Enzymes [BR:bbi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BBIF_0955 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA GARS_A CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADO53160
UniProt: E3EP53
Position
complement(1146665..1147870)
Genome map
AA seq 401 aa AA seqDB search
MDLYEYQARELLEEQHIPTPRAVFAQNSHEVAEAADAIGYPCVIKAQVKIGHRGQAGGVK
IAHNRDEAILLSESILPMTIHGHKVNGVLVAEAKNILHEYYVSISVDRTSRDFDVLATAN
GGTEVEEIAKEHPESVKRLHINALGDFDMEAAKRMAGQIGFYHADLDQAANILLRMWQCF
KDNDATLVEINPLAKIGDPDDEASKSLCALDAKISLDGNAAFRHDGWARFDDPMQADPFE
AAAAEHGLHYVHLDGQVGVIGNGAGLVMSSLDAVWDAGKEQGTNVTPANFLDIGGGASAA
VMSDSLSIVLSDPQVESVFINVYGGITSCEQVAKGILQAFEELHTSKPLVVRFDGNAAAE
GLQILAAANNPNLHVEGTMEQAAAEAARLAANAKASKEAKQ
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggatctttatgaataccaggcacgagaattgctggaggaacagcatattcccacgccg
cgggccgttttcgcccagaactcccacgaggtcgccgaagcggccgatgccatcggatac
ccgtgcgtgatcaaggcccaggtcaagatcggccatcgtggccaggcgggcggcgtcaag
atcgcccacaaccgggacgaagcgatactgctgtccgaatccatcctcccgatgaccatc
cacggccataaggtcaacggtgtgctcgtcgccgaggcgaagaacatcctgcacgagtac
tacgtgtcgatatccgtggaccgcacatcgcgggacttcgatgtcctcgccaccgcgaac
ggcggcaccgaagtcgaggagatcgccaaggaacatccggaatcggtcaagcgtctgcac
atcaacgccctcggcgatttcgacatggaggccgccaagcgcatggctggccagatcggc
ttctaccacgccgacctggatcaggccgccaacatcctgctgcgcatgtggcagtgcttc
aaggacaacgacgcgacgctggtggagatcaacccgctcgccaagatcggcgatcccgac
gatgaggcgtccaaatcactgtgcgccctcgacgccaagatatcgttggacggcaatgcg
gcgttccggcacgacgggtgggcccgcttcgacgatccgatgcaggccgatccgttcgag
gcggcggcagccgaacacgggctgcactacgtccacctcgacggtcaggtcggcgtgatc
ggcaacggcgccggattggtcatgagctcgctcgacgccgtctgggacgccggcaaggag
cagggcacgaatgtcacgcctgcgaacttcctcgacatcggaggtggcgcgtccgccgcg
gtgatgagtgacagcctgtccatcgtgctgtccgacccgcaggtggaatccgtgttcatc
aacgtctacggcggcatcacctcatgcgagcaggtcgccaagggcatcctgcaggcgttc
gaggagctgcacacatcgaagccgctcgtggtccgcttcgatggcaatgccgcagccgag
ggcctgcaaatcctcgccgcggcgaacaaccccaacctgcatgtggaaggcaccatggag
caggccgcagccgaggccgcccgtctggcggcgaacgccaaggcatcgaaggaggccaag
caatga

DBGET integrated database retrieval system