KEGG   Bifidobacterium bifidum S17: BBIF_0997Help
Entry
BBIF_0997         CDS       T01328                                 

Definition
(GenBank) Mucin desulfatase
  KO
K13059  N-acetylhexosamine 1-kinase [EC:2.7.1.162]
Organism
bbi  Bifidobacterium bifidum S17
Brite
KEGG Orthology (KO) [BR:bbi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBIF_0997
Enzymes [BR:bbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.162  N-acetylhexosamine 1-kinase
     BBIF_0997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase Pkinase
Motif
Other DBs
NCBI-ProteinID: ADO53202
UniProt: E3EQ52
Position
complement(1199248..1200336)
Genome map
AA seq 362 aa AA seqDB search
MTDIDPKLAAIVDQFAIDGDVKGITAYGDGHINVTFLINTDQHRYILQKMNTDIFPDTVH
LMRNIELVTAYLRSKNQETLDIVPTKDGASYIENEEVDGAWRIYKFIEGTISYNLVPNAD
VFRESGAAFGEFQNFLAGFDASQLTETIAHFHDTPSRFRDFKAALEADKMGRAETCKPEV
DFFLAHEDQYSRIMDGLADGSVPLRVTHNDTKLNNILMDAKTGKARAIIDLDTIMPGSML
FDFGDSIRFGASTALEDEKDLDKVHFSTELFRAYAEGFVGKVRDSITDKEAELLAFAGNM
MTMECGMRFLADYLAGDTYFATKYPEHNLVRARTQIKLVQEMEQKADEIRAIVDDVMERT
AR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactgacattgatccgaaactggcggccatcgtcgatcagttcgccatcgacggcgac
gtcaagggcatcaccgcatacggtgacggccacatcaacgtcaccttcctgatcaacacg
gatcagcaccggtacatcctgcagaagatgaacacggacatcttcccggacaccgtgcac
ctgatgcgcaacatcgaactcgtcaccgcctacctgcgctccaagaaccaggagacgctc
gacatcgtccccaccaaggacggcgcgagctacatcgaaaacgaggaggtggacggcgcc
tggaggatatacaagttcatcgaaggcaccatctcctacaacctcgtccccaacgccgac
gtgttccgcgagtccggcgccgcgttcggcgagttccagaacttcctggccggcttcgac
gcctcccagctgaccgagaccatcgcccacttccacgacacgccgagccgcttccgcgac
ttcaaggctgcgctggaagccgacaagatgggccgcgccgaaacctgcaagccggaggtc
gacttcttcctcgcccacgaagaccagtactcccgcatcatggacgggctggctgacggc
tccgttccgctgcgcgtcacccacaacgacaccaagctcaacaacatcctgatggacgcg
aagaccggcaaggcccgtgccatcatcgacctcgacaccatcatgccgggttccatgctg
ttcgacttcggcgattccatccgcttcggcgcgtccaccgcgcttgaggacgagaaggat
ctcgacaaggtccacttcagcaccgaactgttccgcgcctacgcggagggcttcgtcggc
aaggtgcgcgacagcatcaccgacaaggaggccgagctgctcgcattcgccggcaacatg
atgacgatggaatgcggcatgcgcttcctcgccgactacctcgccggtgacacgtacttc
gccaccaagtaccccgagcacaacctcgtgcgtgctcgcacccagatcaagctcgtgcag
gagatggagcagaaggccgacgagattcgcgccatcgtcgacgacgtcatggaaaggacc
gcccgctga

DBGET integrated database retrieval system