KEGG   Bifidobacterium bifidum S17: BBIF_1387Help
Entry
BBIF_1387         CDS       T01328                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
bbi00790  Folate biosynthesis
bbi01100  Metabolic pathways
Module
bbi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBIF_1387 (folE)
Enzymes [BR:bbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BBIF_1387 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF RNase_Zc3h12a_2
Motif
Other DBs
NCBI-ProteinID: ADO53592
UniProt: E3EQD6
Position
complement(1673236..1673802)
Genome map
AA seq 188 aa AA seqDB search
MAIDEEGVRKAVRLFLTSIGENPDREGLLETPDRIARACEEIFSGLGRSPQEVLSKRFPV
ETDEMVLVRDIELFSVCEHHLLPFHGVAHVGYIPSNGQVVGLSKLARLVELYARRPQVQE
RITQQVADALMEYADAKGVIVVTECEHMCMAMRGVNKPASRTITSAVRGVMRTPATRAEA
MSLIMAKH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgacgaagagggcgtgcgcaaggccgtacggctgttcctgacttcgatcggc
gagaatcccgatcgcgagggtctgctggagacgcctgaccgtatcgcacgtgcctgcgag
gagattttctcagggctcggacgcagcccgcaggaggtgctgtctaagcgtttcccggtc
gagaccgatgaaatggtgctggtgcgcgacatcgagctgttctcggtgtgcgagcatcat
ctgcttccgttccacggcgtcgcgcatgtcggctacatcccgtccaacgggcaggtcgtc
ggattgagcaagctcgcccgactggtggagctgtacgcgcgtcgcccgcaggtgcaggaa
cgcatcacccagcaggtcgcggacgcgctgatggaatacgcggacgccaagggcgtcatc
gtcgtgaccgaatgcgagcacatgtgcatggcgatgcggggcgtgaacaagcccgcgtcg
cgaaccatcacatcggcggtccgcggcgtgatgcgcaccccggccacccgtgccgaggca
atgagtctgatcatggccaagcactga

DBGET integrated database retrieval system