KEGG   Borreliella burgdorferi JD1: BbuJD1_0151Help
Entry
BbuJD1_0151       CDS       T02081                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bbj  Borreliella burgdorferi JD1
Pathway
bbj00520  Amino sugar and nucleotide sugar metabolism
bbj01100  Metabolic pathways
bbj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BbuJD1_0151 (nagA)
Enzymes [BR:bbj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BbuJD1_0151 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 DsrH
Motif
Other DBs
NCBI-ProteinID: ADQ30711
Position
150829..152034
Genome map
AA seq 401 aa AA seqDB search
MPNFCLFNSKSVLTGNDKIDNSAVLIKDNKIFDIVTSDRLKKMDLEEYQMIDTKGNYITP
GLYDNHIHGFHGHGTDQCSTESILKMSEHLAQYGVVGFLPTLYPRPIDEMIKTIKACIAA
IGKEKGAKILGLHLEGPFFSPEKKGAHPVSYLHEPSIEVMQKLIDAAGGVFTGSNGKRKT
HISTMTVAPELKGMRELAIFCLENNINLQAGHTNATYENMIEGFQVGILHTTHFFNAMSK
LDHRNPNAIGAVLIHGDVSCEIIADGHHIHPKLILMLRKLKDISKIVLVTDGLTPNCQTC
GKLIANGDEVYIAEDGLFHSVKSNTIAGSTLTMIQGLKNLIEFGFSLSDAVQASSYNPTR
ILNIDKKGLICHGYDANLNVLDKDFNLKLTMIESKIIFNNL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatttttgcttatttaactcaaaatccgttttaactggaaatgataaaatagat
aactcagcggttctaattaaagataataaaatttttgatattgtaacgtctgacagactt
aaaaaaatggatctcgaagaataccaaatgattgacacaaaaggcaattatataactccc
ggactttacgacaatcatattcatggatttcacggtcatgggacagaccagtgttcaaca
gaatcgatacttaaaatgtcagaacatttagcacaatacggtgtagtaggatttttacca
accctttacccaagaccaatagatgaaatgattaaaacaataaaagcttgcatagcagca
attggtaaagaaaagggagctaaaattttgggacttcaccttgaaggaccatttttctct
cctgaaaaaaaaggagctcatccagtttcttatcttcatgaacctagtattgaagttatg
caaaaactaatagatgcagctggtggagtatttacaggatcaaacggcaaaagaaaaaca
catataagcacaatgactgttgctcctgagcttaagggtatgagagagcttgcaatattt
tgccttgaaaacaacataaaccttcaagcgggacacacaaatgcaacatatgaaaacatg
atagaaggatttcaagttggaatacttcatacaacccattttttcaacgcaatgtcaaaa
cttgaccacagaaatccaaatgcaataggagcggtgttaatacacggcgatgtttcttgc
gaaattattgcagatggccaccatatacacccaaaattaattttaatgcttagaaagctt
aaagatataagtaaaatagtccttgtaactgacggacttactccgaattgtcaaacttgt
ggaaaactaattgcaaacggagacgaagtttatattgcagaagatggattattccatagc
gtgaaaagcaacacaatagctggatcaacactcacaatgatacaaggtcttaaaaattta
atagaatttggtttcagcttaagcgatgctgttcaagcaagctcttacaatccaacaaga
attctcaatattgataaaaagggcttaatatgtcatggatatgatgcaaacctcaatgtc
ctagataaagattttaatctaaagttaacaatgatagaatctaaaataatttttaacaat
ctctaa

DBGET integrated database retrieval system