KEGG   Bartonella bacilliformis: BARBAKC583_0120Help
Entry
BARBAKC583_0120   CDS       T00456                                 

Definition
(GenBank) polyprenyl synthetase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
bbk  Bartonella bacilliformis
Pathway
bbk00900  Terpenoid backbone biosynthesis
bbk01100  Metabolic pathways
bbk01110  Biosynthesis of secondary metabolites
bbk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BARBAKC583_0120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bbk01006]
    BARBAKC583_0120
Enzymes [BR:bbk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BARBAKC583_0120
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BARBAKC583_0120
Prenyltransferases [BR:bbk01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BARBAKC583_0120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ABM44695
UniProt: A1UR55
Position
complement(135152..136054)
Genome map
AA seq 300 aa AA seqDB search
MHEFTTLLAKHADAVKQRLNMLLNNHVQEGEIARPELLLQAMRYGVLNGGKCLRPFFVIQ
SAALFDVPPEHALDVGVALECIHCYSLIHDDLPAMDNDILRRGKPTVHKAFDEATAILAG
NALLTFAFEIIAHKACALLPQTRLNLITALAQAAGLGGMIGGQILDLEAEKKPQDRTKIL
TLQRMKTAALISFSCQAGAIMGNASASITQQFADFGTQIGLAFQLTDDLLDVTSSTEILG
KTAGKDKAANKATLVNIDGIAETQKKRDTLIHDAVKLLNPFGDKALALQQAAHFIAIRRH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaattcacgacccttcttgcaaaacatgctgacgctgttaaacaaaggctgaac
atgcttttaaacaatcacgtgcaagagggtgaaattgctcgccccgagctcttactgcaa
gccatgcgttatggtgttttgaatggtggcaaatgcttgcgtcctttttttgttatccaa
agtgctgcactttttgatgttccccccgaacatgcgcttgatgtcggcgtagcattagag
tgcatccattgttattcgctcattcatgatgaccttcctgctatggataacgatatttta
cgacgtggtaaacctactgttcataaagcttttgacgaagccacagcaattcttgcaggc
aatgccctgcttacttttgcgttcgaaattattgcacataaagcctgtgccctgctccct
caaaccagactgaacctcattacagctctggcacaagctgcaggacttggcggcatgatt
ggcggtcagatccttgaccttgaagcagaaaaaaaaccgcaagaccgcacaaaaatcctc
actttgcaacgtatgaaaacagccgcgttgataagtttttcttgccaagccggtgccata
atgggcaatgcttccgcatccataacccagcaattcgccgattttggtacacaaattggc
ctcgcatttcaattaacggatgatcttctcgatgtcaccagcagcactgaaattctgggc
aaaactgctggaaaagataaagctgccaacaaagcgacactggttaatattgatggcatt
gcagaaacacaaaaaaaacgagacacactgatccatgacgctgtaaagcttctcaaccct
tttggtgataaagctcttgccctgcaacaagccgcccattttattgcaatacgcagacat
taa

DBGET integrated database retrieval system