KEGG   Bartonella bacilliformis: BARBAKC583_0528Help
Entry
BARBAKC583_0528   CDS       T00456                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbk  Bartonella bacilliformis
Pathway
bbk00010  Glycolysis / Gluconeogenesis
bbk00051  Fructose and mannose metabolism
bbk00562  Inositol phosphate metabolism
bbk01100  Metabolic pathways
bbk01110  Biosynthesis of secondary metabolites
bbk01120  Microbial metabolism in diverse environments
bbk01130  Biosynthesis of antibiotics
bbk01200  Carbon metabolism
bbk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BARBAKC583_0528 (tpiA)
   00051 Fructose and mannose metabolism
    BARBAKC583_0528 (tpiA)
   00562 Inositol phosphate metabolism
    BARBAKC583_0528 (tpiA)
Enzymes [BR:bbk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BARBAKC583_0528 (tpiA)
Exosome [BR:bbk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BARBAKC583_0528 (tpiA)
  Exosomal proteins of bladder cancer cells
   BARBAKC583_0528 (tpiA)
  Exosomal proteins of melanoma cells
   BARBAKC583_0528 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABM44445
UniProt: A1US90
Position
536964..537728
Genome map
AA seq 254 aa AA seqDB search
MTSSIRPLLAGNWKMNGTSESLRELRAIASGIDSDRDRCFEALVCVPATLLSRASDILSD
ENIFLGGQDCHFNDSGPHTGDISACMLKEAGASHVILGHSERRTDYRESDAIVCAKVKAA
WRAGLVALICIGETLEERENNTVLDVLAQQLKGSVPAGAMDHNTVIAYEPRWAIGTGKTP
TSEDIAQVHGFIRKEVSHRFGDEGHKIRLLYGGSVKPSNASELLETSHVNGALIGGASLK
ATDFLTICNIYRKL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacttctagtattcggcctttgcttgccggaaattggaaaatgaatgggactagcgaa
tctcttagagaattacgggctattgcttctggtattgattctgaccgagatcgttgcttt
gaagcgcttgtttgtgttccagcaacacttttatcacgtgcttctgatatattaagtgat
gaaaatatttttttaggggggcaagattgccattttaatgatagtggtcctcatactgga
gatatttcggcatgtatgcttaaagaagcaggagcaagtcatgtcattcttggacattca
gagcgccgtacagattatcgtgaaagtgatgcaattgtctgtgctaaagtgaaagctgcg
tggcgggcaggtcttgtggctcttatttgtattggtgaaacattagaagagcgtgaaaat
aacacagtgttggatgtgcttgcacagcaacttaaaggatccgtgccagcgggagcaatg
gatcacaataccgttattgcttatgaaccgagatgggctataggtacaggaaagacacct
acttcagaagatattgcacaagtgcatggtttcattcgtaaagaggtcagccatcgtttt
ggtgatgaggggcacaaaatacgcttgctttatggtggatcagtcaaaccatccaatgca
tctgagcttttggagacgagtcacgttaatggtgctctgattggtggagcaagcttaaaa
gcaactgattttttaactatttgcaacatttatcgtaaattataa

DBGET integrated database retrieval system