KEGG   Bartonella bacilliformis: BARBAKC583_0644Help
Entry
BARBAKC583_0644   CDS       T00456                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bbk  Bartonella bacilliformis
Pathway
bbk00790  Folate biosynthesis
bbk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BARBAKC583_0644 (folE)
Enzymes [BR:bbk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BARBAKC583_0644 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABM44443
UniProt: A1USJ5
Position
662083..662703
Genome map
AA seq 206 aa AA seqDB search
MHSAVEKVAEDLSLSRENLSLEEVEKAIRTLLLWVGENPDREGLLETPKRIAKVYKELFS
GYGESVDEILGVVFEEVAGYDEPVIVKDIFFYSHCEHHMIPIIGKAHVAYLPDKKIVGLS
KIARVVDVFAHRLQTQETMTAQVANSLKKYLKPRGLAVLIEAEHMCMAMRGVQKQGAATI
TTSFHGYYKKDQVAQANFMTITRGIR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcatagtgctgtggaaaaagtggctgaagacctgtctttatctagggagaatcttagc
ttggaagaagtagaaaaggcgattcgcacactattgttatgggtaggggagaacccagat
cgagaaggacttttagagactccaaagcgtattgctaaagtctataaggaattattttct
ggttatggtgaatccgttgatgaaattttaggcgtagtttttgaagaagttgcaggatat
gatgagccggtaatcgtaaaagatatcttcttttattcacattgtgagcatcatatgatt
ccgataattggtaaagctcatgtagcatatcttcctgataaaaaaattgttggtctttca
aaaattgcgcgcgtcgtagatgtttttgctcatcgtttgcaaacacaagaaactatgaca
gctcaagtggctaatagtttgaaaaaatatctaaaacctcgcggtcttgcggtgttgatt
gaggctgaacatatgtgcatggctatgagaggtgtacaaaagcaaggagcagcaacaata
acaacaagctttcatggttattataaaaaagatcaagttgcacaggccaatttcatgaca
ataacccgtgggatacgttaa

DBGET integrated database retrieval system