KEGG   Bartonella bacilliformis: BARBAKC583_1361Help
Entry
BARBAKC583_1361   CDS       T00456                                 

Gene name
argG
Definition
(GenBank) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
bbk  Bartonella bacilliformis
Pathway
bbk00220  Arginine biosynthesis
bbk00250  Alanine, aspartate and glutamate metabolism
bbk01100  Metabolic pathways
bbk01110  Biosynthesis of secondary metabolites
bbk01130  Biosynthesis of antibiotics
bbk01230  Biosynthesis of amino acids
Module
bbk_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bbk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BARBAKC583_1361 (argG)
   00220 Arginine biosynthesis
    BARBAKC583_1361 (argG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbk04147]
    BARBAKC583_1361 (argG)
Enzymes [BR:bbk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     BARBAKC583_1361 (argG)
Exosome [BR:bbk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BARBAKC583_1361 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth Asn_synthase QueC
Motif
Other DBs
NCBI-ProteinID: ABM45481
UniProt: A1UUF5
Position
complement(1433381..1434604)
Genome map
AA seq 407 aa AA seqDB search
MNKWTDVKKVVLAYSGGLDTSIILKWLQSELGAEVVTFTADLGQGEELESARRKAEIMGI
KEIYIEDLREEFVRDFVFPMFRANAVYEGVYLLGTSIARPLISKRLIEIAKETGADAIAH
GATGKGNDQVRFELSAYALDPDIKIIAPWRDWTFKSRTDLIEFARVHQIPVEKDKEGEAP
FSVDANLLHSSSEGKILENPAIPAPEYVHMRTLSPETAPDKATIITIGFKKGDAVSINGE
MLSPATLLAQLNNYGRDNGIGRLDLVENRFVGMKSRGIYETPGGTILLTAHRAIESLTLD
RGAAHLKDELMPRYAELIYYGFWFSPERKMLQAAIDLSQEHVEGEVTLKLYKGNVIVEGR
QSKKSLYFDKLVTFEDDQGAYDQKDAAGFIKLNALRLRTLAARSSVL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatggacagatgttaagaaagttgttttggcctattcggggggattggataca
tcgattattctcaaatggttgcaaagcgaattgggtgctgaagttgtaacttttacagct
gatttaggtcagggggaagagttagagtctgcgcgtcgtaaagctgaaataatgggtatt
aaagagatctatattgaagatttgcgtgaagaatttgtgcgtgattttgtatttcccatg
tttcgagcaaatgcagtctatgaaggggtctatcttttaggaacgtcaattgctcgtcca
cttatttcaaaacgtctcattgaaattgctaaggaaaccggagctgatgcaattgctcat
ggtgcaacaggaaaagggaatgatcaagttcgttttgaactttctgcttatgctcttgat
cctgatataaaaattattgctccatggcgagattggacttttaaaagtcgaacagattta
attgaatttgcacgtgtgcatcaaattccagtagagaaagataaggaaggtgaagcacct
ttttcggtagatgcaaatttattgcattcatcatcagaagggaagattttggagaatcct
gctattcctgctcctgaatatgtgcatatgcgcactctttcgccggagactgctccagat
aaagcaacgataatcacaatcggctttaaaaaaggtgatgctgtttcgattaatggagaa
atgttatctccagctaccttactggctcaattgaataattacggacgtgacaatggtatc
ggtcggttagatttagttgaaaaccgctttgtgggtatgaaatcgcgtggcatttatgaa
acaccaggaggaaccattctcttaacagctcatcgagcgatagaatccttaaccttagat
cgcggtgcagcgcatttgaaagatgaattaatgccacgttatgcagagctgatttattat
ggcttttggttttcacctgagcgtaaaatgttgcaggcagctattgatttatctcaagaa
catgttgaaggagaggttacattgaagctttataagggtaatgtgattgttgagggtcgg
caaagtaaaaagtcgctttattttgataagttggtaacttttgaagatgatcagggtgct
tatgatcaaaaagatgctgctggattcattaaattaaacgctctgcgcttacgcacatta
gcagcacgttcatcagtattatga

DBGET integrated database retrieval system