KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_283Help
Entry
BLBBGE_283        CDS       T00995                                 

Gene name
serA
Definition
(GenBank) phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Pathway
bbl00260  Glycine, serine and threonine metabolism
bbl00680  Methane metabolism
bbl01100  Metabolic pathways
bbl01120  Microbial metabolism in diverse environments
bbl01130  Biosynthesis of antibiotics
bbl01200  Carbon metabolism
bbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    BLBBGE_283 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLBBGE_283 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbl04147]
    BLBBGE_283 (serA)
Enzymes [BR:bbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     BLBBGE_283 (serA)
    1.1.1.399  2-oxoglutarate reductase
     BLBBGE_283 (serA)
Exosome [BR:bbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BLBBGE_283 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh IlvN NAD_binding_2 F420_oxidored AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ACY40304
UniProt: D0JAW6
Position
complement(272269..273216)
Genome map
AA seq 315 aa AA seqDB search
MIKRILILEKNHPFIIYKLKKEGFICDENYYDSTNEIDPFVYDGLILRSRLKIDKKFIKK
AKNLKFIARIGSGIENIDTDYVLKKGIVLISSPEGNKDAVAEHAIGMLLCAMNHILRSHQ
QIKKGKWYRENNRGMEIMEKTIGIIGYGNTGKAFAKKLSGFDAKILCYDILPKIGDAYAK
QVDMSTIFKKSDIISLHVPYTKETKGMINYDFIKKFCKPFYFINTSRGGCVITNHLIKAL
KDGKIHGACLDVLEYENFSFENIFHHHKLPKNFFEMIHSNKIILTPHIAGWTKESKYKMD
KKIVEKIILLNKKLN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaagaatattaattttagaaaaaaatcatccttttattatatacaaactaaaa
aaagaaggatttatttgtgatgaaaattattatgattcaaccaatgaaattgatccattt
gtatatgatggtttaattttaagaagcagactaaaaatagataaaaaatttattaagaaa
gctaaaaacttaaaatttatagccagaatcggatctggaatagagaatatagatacagat
tatgttttaaaaaaagggattgttttgatttcttctccagaaggaaataaagatgctgta
gcagaacatgctataggaatgcttttatgtgccatgaaccatattcttagatctcatcaa
caaatcaaaaaaggaaaatggtatagagaaaataatagaggaatggaaattatggaaaaa
acaataggaattattggatatggaaatactggaaaagcttttgcaaaaaaactttcagga
tttgatgccaaaatattatgttatgatattttgcctaaaattggggatgcttatgcaaaa
caagtagacatgagtacaatttttaaaaaatcagatataattagtttgcatgttccttat
acaaaagaaacaaaaggaatgattaattatgattttataaaaaaattttgcaaacctttt
tatttcataaatacttctcgtggaggatgtgttattacaaatcatttaatcaaagcatta
aaagacggaaagatacatggagcctgtttagatgtattagagtatgaaaatttttctttt
gaaaatatttttcatcatcataaacttcctaagaatttttttgagatgattcattctaat
aaaatcatattaaccccacatattgctggatggactaaagaatctaaatataagatggat
aaaaaaattgtcgaaaaaattattttattaaacaaaaaactcaattga

DBGET integrated database retrieval system