KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_284Help
Entry
BLBBGE_284        CDS       T00995                                 

Gene name
mrcA
Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00550  Peptidoglycan biosynthesis
bbl01100  Metabolic pathways
bbl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLBBGE_284 (mrcA)
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    BLBBGE_284 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bbl01003]
    BLBBGE_284 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbl01011]
    BLBBGE_284 (mrcA)
Enzymes [BR:bbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BLBBGE_284 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BLBBGE_284 (mrcA)
Glycosyltransferases [BR:bbl01003]
 Polysaccharide
  Bacterial polysaccharide
   BLBBGE_284 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:bbl01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BLBBGE_284 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase DUF1957 Sigma_reg_N
Motif
Other DBs
NCBI-ProteinID: ACY40305
UniProt: D0JAW7
Position
complement(273220..275523)
Genome map
AA seq 767 aa AA seqDB search
MYKKSIKKNSSFRILIFYFWFLFFIGISTIFVIFYAASKGYLGALPGTKDIETPTMEVGS
EVYDSNGILLGRFFSENRTLITYKQLPKDLVNALIAKEDIRFKYHSGIDAKSLLRAILSL
GKKGGGSTISQQLAKLLFTGASAKNKLQRIHQKLLEWVMAIELEKRYTKEEIITMYYNKF
DFLYNAKGIETAAHTYFNKKASELNLGECATLVGMLENPSLYNAKNYPERAKKQRNLVLY
QMKKYNFLNTYRYEKELEKPIKINFKIQKRDFELLTYYGEFLKKEIQEALDEHENKTGQK
LNLYSSGLKIYTSIDARMQDYAEKAVRKHLSKLQILFNHLQKKNKNAPFLNISQEKTKRI
LISAMHRTPLYQDLKQKGLAEDQIFKKFQKPQSIKLFTWNGPKKVLISPWDFIRYQKSII
QAGLLSIEPSTGFIKAWVGGIDFNYFQYDHVAQTQRQVGSVFKPILYATAINELHYNPCT
KISNEKFHLGKWSPRNSNGKYGGFLTLKDGLALSVNTISARLISQMTPGPVINLARKMGI
KSMIPEHPSIALGSADLTLYEMTGAFNTFTNYGFYVKPSILVKIEDENGNIIKENTEIGK
RQVFSEEVAYIMLKLMQGVVKYGTAKRLQKYNFIGDIAGKTGTTNENSDGWFIGMVPNLT
TGVWVGWEDRFSHFENIQFGQGANMALPIWAYYMKSIYKDINLIYQDQLFFHKPKNYQYH
WDQCEENHVFKEENVIINEEKENKNSLKEIMNINDNLNKENNKDYDK
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
gtgtataaaaaaagtataaaaaaaaattcttcttttcgtatacttattttttatttttgg
tttttattttttataggaataagtactatattcgtgattttttatgctgcttctaaaggt
tatttaggagctttacctggaactaaagatatagaaacccctactatggaagtagggtca
gaggtatatgattctaatggaattctattgggtagatttttttctgaaaatagaacttta
attacttataaacaacttccaaaagatcttgtcaatgctttaattgcaaaagaagatatt
cgttttaaatatcattctggaattgacgctaaatctctacttagagcaattctttcacta
ggaaaaaaaggaggtggcagcactatatctcaacaattggcaaaacttctttttacagga
gcatcagcaaaaaataaactccaaagaattcatcaaaaacttttagaatgggtcatggcc
attgagctagaaaaacgttatacaaaagaagaaattattacaatgtattataataaattc
gattttttatataatgcaaaaggtatagaaacagcagctcacacttatttcaataaaaaa
gcttctgaactgaatttaggagaatgtgctacgttggttggaatgttagagaatccttct
ttatataatgctaaaaattaccctgaaagagcaaaaaaacaaagaaatttagttctatat
caaatgaaaaaatataattttttaaatacatatagatatgaaaaagaattagaaaaacct
ataaaaattaattttaaaatacaaaaacgagattttgaattacttacttattatggtgaa
tttttaaaaaaagaaattcaagaagctttagatgaacatgaaaataaaactggacaaaaa
ttgaatctttattctagcggattaaaaatatatacatccattgatgcaagaatgcaagat
tatgctgaaaaagcagtcagaaaacatctcagtaaattgcaaattttattcaatcattta
caaaaaaaaaataaaaacgccccatttttgaatatttctcaagaaaaaacaaaaagaata
ttaatatctgctatgcatagaactcctctttatcaagatttgaaacaaaaaggattagca
gaagatcaaatttttaaaaaatttcaaaaaccacaatccataaaattatttacttggaat
ggtcctaaaaaagtattaatttccccatgggattttattcgttatcaaaaaagcattatt
caagctggtttgttatctatagaaccatctacgggttttataaaagcatgggtaggagga
atagattttaactattttcaatatgatcatgtagcacaaacacaacgtcaagttggttct
gttttcaaacctattttatatgccactgctattaatgaattacattataatccttgcact
aaaatttcaaatgaaaaatttcatttaggaaaatggagtcctagaaattccaatggaaaa
tatggagggtttttaacattaaaagatggtttagctttatctgtcaatacgatttcagct
agattgatatcacaaatgactccaggtccagtaattaatttagcaagaaaaatgggaatt
aaatctatgattcctgaacatccatctatagcgcttggatctgcagatttaacattgtat
gaaatgacaggagcatttaatacatttactaattatggattttatgtaaaaccctctatt
ttggtaaaaatagaggatgaaaacggaaatataatcaaagaaaatacagagattgggaaa
agacaagtttttagtgaggaagtagcatatatcatgttaaaactcatgcaaggagttgtt
aaatatggaacagctaaaagattgcaaaaatacaattttataggagatatagcaggaaaa
actggaacaacaaatgaaaactcagacgggtggttcataggaatggttccaaatttaact
actggagtttgggtaggttgggaagatcgattttctcattttgagaatattcaatttgga
caaggagcaaatatggctttgcctatatgggcttattatatgaaaagtatatataaagat
attaatctgatttatcaggatcaattattttttcataaacctaaaaattatcaatatcac
tgggatcagtgtgaagaaaatcatgtttttaaagaagaaaatgtgattataaacgaggaa
aaagaaaacaaaaactctttaaaagaaattatgaatattaatgataatttaaataaagaa
aataacaaggattacgataaatga

DBGET integrated database retrieval system