KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_294Help
Entry
BLBBGE_294        CDS       T00995                                 

Gene name
pgk
Definition
(GenBank) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00010  Glycolysis / Gluconeogenesis
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01120  Microbial metabolism in diverse environments
bbl01130  Biosynthesis of antibiotics
bbl01200  Carbon metabolism
bbl01230  Biosynthesis of amino acids
Module
bbl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLBBGE_294 (pgk)
Enzymes [BR:bbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     BLBBGE_294 (pgk)
Exosome [BR:bbl04147]
 Exosomal proteins
  Proteins found in most exosomes
   BLBBGE_294 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-ProteinID: ACY40314
UniProt: D0JAX6
Position
complement(284002..285210)
Genome map
AA seq 402 aa AA seqDB search
MIEGIKTVNNFDFKNQIALMRVDFNVPIDKYYNITDDTRIQSTLPTIQKILSEKGKIILI
SHFGRPKGKPSKTYSLKFLIPFLSEKLKLTVDFCENCIGKNVEQKIHQLKNGKILLLENL
RFYKEEEEGNENFAFELSKLGDIYVNDAFGVSHRSHTSISLLPKFFGKKKCIGLLMQKEI
QFLNKFLSGKGKKPITVILGGAKISSKIEIIENIIDFADHILIGGGMSYPFIKMKGGKIG
NSIVEKNQIIEETLNKILNKCQEKNKKLSFPKDVIIADSFKNTANTKISSIHSIPDRWMG
LDIGPSSIKYFCNIIEKSNTILWNGPVGVFEFPNFSLGTRFIAKTIAKRTEKGAFSLVGG
GDSIASLKMEGCNNKISYLSTGGGALLESLKNKILPGIKAII
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgatagagggtataaaaactgtcaacaattttgattttaaaaatcaaatagcattgatg
agagtagattttaatgttcctatagacaaatattacaatataacagatgatactcggatt
caatccacccttcctactattcaaaaaatactttctgaaaaaggaaaaataattctcatt
tctcactttggaagacctaagggaaaaccatctaaaacttattctttaaaatttttaatt
ccttttctatccgaaaaattaaaattaactgtggatttttgtgaaaattgtataggaaaa
aatgtagaacaaaaaattcatcaattaaaaaatggtaaaattttgttattagaaaatctt
cgtttttataaagaagaagaagaaggtaatgaaaattttgcttttgaattatcgaaatta
ggagatatttatgtaaatgacgcttttggagtttctcatcgttcacatacttctatttct
cttcttcctaaattttttggaaaaaaaaaatgcataggacttctcatgcaaaaagaaatt
caatttttgaacaaatttctatcaggaaaaggaaaaaaacctattacagttatattagga
ggagcaaaaatttcttctaaaatagaaattattgaaaatattattgattttgctgatcac
atattaataggaggaggaatgtcttatccttttattaaaatgaaaggaggaaaaatagga
aattctattgttgaaaaaaatcaaataattgaagaaacattaaataagattcttaacaaa
tgtcaagaaaaaaacaaaaaattatcttttccaaaggacgtgattattgctgattcattt
aaaaatacagcgaatactaaaatttcatctattcattctattccagatagatggatggga
ttagatataggtccttcttctataaaatatttttgcaatattatagaaaaatcaaatact
attttatggaatggtccagtaggagtttttgaatttcccaatttttctttggggaccaga
tttatagccaaaacaattgcaaaaagaactgaaaaaggagctttttctctagtaggagga
ggagattctattgcttctctcaaaatggaaggatgtaataataaaattagttatttatct
actggggggggggctttgttggaaagtttaaaaaataaaatacttcctggaataaaagca
attatataa

DBGET integrated database retrieval system