KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_300Help
Entry
BLBBGE_300        CDS       T00995                                 

Definition
(GenBank) methyltransferase
  KO
K07056  16S rRNA (cytidine1402-2'-O)-methyltransferase [EC:2.1.1.198]
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bbl03009]
    BLBBGE_300
Enzymes [BR:bbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.198  16S rRNA (cytidine1402-2'-O)-methyltransferase
     BLBBGE_300
Ribosome biogenesis [BR:bbl03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    BLBBGE_300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Sec3_C
Motif
Other DBs
NCBI-ProteinID: ACY40318
UniProt: D0JAY0
Position
complement(287584..288246)
Genome map
AA seq 220 aa AA seqDB search
MLYIVPTPIGNLEDFTFRGLRILKEVDLVLVESYKVSKKLLNFYNIKTQINKYHIYNEHK
IIPHLIKEIKKGKKLALISNAGTPSISDPGFLLIQSCIKASISVECLPGPTALIPALVSS
GLPINEFTFIGFLPKKKKIKLENLSRENRTIVFYESPHRLLQTLNDIKHFFGLKRNIVVC
KEMSKFFQNILRGNIEKIISYYENVEKILGEYTILIEKSS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgttatatattgtccctactcctataggaaatctagaagactttactttcagagggtta
cgaatattaaaagaggtagacttggttttagtggaaagttataaagtctccaaaaagttg
ttgaatttttataatattaaaactcaaataaataaatatcatatttataatgaacataaa
ataattcctcatcttatcaaagaaattaaaaaaggaaaaaaattagctttaatatctaat
gcggggactcctagtatatctgatccaggttttttgttaatacaatcttgtataaaagct
tctatttctgtagaatgtttacccggaccaacagctctaattccagcattggtgagttca
ggcctacctattaatgagttcacttttattggttttttaccaaaaaaaaagaaaattaaa
ttagaaaatttgtcaagagaaaacagaactattgtattctatgaatctcctcatagattg
ttacaaacattaaacgatataaaacatttttttggattgaaaagaaacattgtagtttgc
aaagaaatgtccaaattttttcaaaatatattaagaggaaatatagagaaaattatttca
tattatgaaaatgttgagaaaatattaggagaatataccattcttattgaaaagagctct
taa

DBGET integrated database retrieval system