KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_320Help
Entry
BLBBGE_320        CDS       T00995                                 

Definition
(GenBank) bifunctional peptidase/acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Pathway
bbl00220  Arginine biosynthesis
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01130  Biosynthesis of antibiotics
bbl01210  2-Oxocarboxylic acid metabolism
bbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BLBBGE_320
Enzymes [BR:bbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     BLBBGE_320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: M20_dimer Peptidase_M20
Motif
Other DBs
NCBI-ProteinID: ACY40333
UniProt: D0JAZ5
Position
316307..317386
Genome map
AA seq 359 aa AA seqDB search
MSVVNLQVLKEEAIQLLIQLINTPSISKQENKVSFLIEDYLHKYGFHVKRKFNNIWTEND
NYLKKENIRTILFNSHHDTVKPGKNWKTNPFSAIKQEDKLIGLGSNDAGASVVSLISTFI
YLSGLSELPYRLILSITAEEEISGPLGIRAILPELGCIDLGIVGEPTQMQVAIAEKGLMV
LDCVAEGKTGHSARDIGINAIYVATKDIEHLRNLYFDKKSELLGCTTLNVTQIQGGIQHN
VIPDFCSFVVDIRTNELYKNEEIIEIIQKKIHSKMKPRSSHLNSSFINPMHPIVLKAKRI
GRKTYGSPTLSDQSIMPFSTIKMGVGDSVRSHTPNEYILISEIMEGIEIYISLLKDFSF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagtcaatttgcaagttttaaaggaagaagctatccagcttttgatacaatta
atcaacacaccttctatatccaaacaagaaaataaggtctcttttcttatagaagattat
cttcataaatatggatttcatgtaaaaagaaaatttaataatatatggactgaaaatgat
aattatttaaaaaaagaaaatatacgaactatactattcaattctcatcatgatacggta
aaaccaggaaaaaattggaaaacaaatcctttttctgctataaaacaagaagataaacta
ataggattaggtagtaatgatgctggagcttccgtcgtttcattaatatctacttttata
tatttaagtggattatcggaattaccttacagattgattctttcaattaccgcggaagaa
gaaatatctggacctttaggtattagagccattttacctgagttgggatgtatcgactta
ggaattgtaggggaacctacacagatgcaagtggctattgctgaaaaaggattaatggtg
ttagattgtgtagccgaagggaaaacaggacattctgcaagagatataggaattaatgct
atttatgtagcgacaaaagacatagaacacttaagaaatttatattttgataaaaaatca
gaattgctaggttgtacgaccttaaatgttactcaaatacaaggaggaatacaacataat
gtgattcctgatttttgttcttttgtagtagatattagaaccaatgaattatataaaaac
gaggaaatcattgaaattatacaaaaaaaaattcactctaaaatgaaacctcgttcttct
catttaaattcttctttcataaatcctatgcatcccattgttttaaaagctaaacgaata
ggaagaaaaacttatggatctcctaccctttcagaccaaagcattatgcctttttcaacc
attaaaatgggagttggagatagtgtacgttctcatacgcctaatgaatacattttgatt
tcagaaatcatggaaggaatagagatttatatctctttgttaaaagacttttccttttga

DBGET integrated database retrieval system