KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_325Help
Entry
BLBBGE_325        CDS       T00995                                 

Gene name
ftsK
Definition
(GenBank) cell division protein
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bbl03036]
    BLBBGE_325 (ftsK)
Chromosome and associated proteins [BR:bbl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BLBBGE_325 (ftsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE FtsK_alpha FtsK_4TM AAA_10 DUF87 AAA_22 DEAD Peptidase_U57 AAA_19 T2SSE
Motif
Other DBs
NCBI-ProteinID: ACY40337
UniProt: D0JAZ9
Position
complement(319669..321441)
Genome map
AA seq 590 aa AA seqDB search
MLLSFFSFLFHWKNDQSQLEKLFDKEIIAENLLGKMGAVVSHYFIYCGIGISVFFVPILL
FITGLRILFVRKKLLNDFYKSTICKFIFFSIWLPITFYLVIPDQGIFSGIFGFEIGNLLI
HLFGKIGSYILIFTSIIFYFIIIFRMNPPKNGIPQKIQSYEETDTIFKLCNKLCNFFLNT
KIVNRPLKKTNESSPKNKNILHSIFSKKDFSSISVNNLEIDSNKKKIVQVLNYYKIEICQ
IKAIIGPTIILYEIYPKVGTRISKIKNLKNEIALNLSAISIRIIAPMPGKGSIGIEIPNH
NRYPVYMKDILFSEESHKMSHEMELPISLGKTVFNKIFVIDLTKMPHLLIAGSTGQGKSV
GLNVMIIFLLYQKNPEDIKFILIDPKKVELSVYKKISKSYFAAIPNSIEPIITDLHQVKN
ILNSLCKEMDKRYALLEKYKVRNIQEYNQKYHLPYIILIIDEFADLSFSFYQKKQIETYI
TRLAQLARAVGIHLIIATQRPSVDVITGLIKSNFTARIAFRVSSKIDSRTILDCSGAEQL
IGKGDLLFSNRNELIRLQCPFIDLSDIQKIVDFYKKNDKKNEYFFLPEPD
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
ttgttattaagttttttttctttcctttttcattggaaaaatgatcaaagccaattggaa
aaactttttgataaagaaatcatagcagaaaatttacttggaaaaatgggggctgtagtc
tctcactatttcatttactgtggaataggaattagtgtgttttttgttcctatattactg
tttatcacaggattaagaattctttttgtaagaaaaaaactattgaatgatttttataaa
tcaacaatatgtaaatttatattttttagtatatggcttccaataactttttatcttgtt
attcctgatcaaggaatatttagtggaatttttggatttgaaatagggaatttgttgatc
catttatttggaaaaataggatcatatatacttatttttacgagtattattttttacttt
atcattatttttcgtatgaatcctccaaaaaatggaattccacaaaaaatacaatcttac
gaagaaacagatacaatcttcaaattgtgcaataaattgtgcaatttttttttaaataca
aagattgttaatagaccattgaaaaaaacgaatgaatccagtccaaaaaataaaaacatt
ctccattctattttttctaaaaaagatttttcttccatatcagtgaataacctagaaata
gattctaataaaaaaaaaatagtccaagtacttaactattataaaatagaaatatgtcaa
ataaaagcgattataggacctactatcattttgtatgaaatttatcctaaggtaggaaca
agaatctcaaaaataaaaaatttaaaaaatgaaatcgccttaaatttatctgctatatcc
ataagaattatagctcccatgcctggaaaaggatccattggaatagaaattccgaatcat
aatcgttatcctgtttatatgaaagacattcttttttcagaagaaagtcacaaaatgagt
catgaaatggaactcccgatttctttaggaaaaacagtatttaataaaatttttgttata
gatttaactaaaatgcctcatttacttatagcaggatcaactggacaaggcaaatccgta
ggattaaatgttatgattatttttttgttatatcaaaagaatccagaagatatcaaattt
attttgattgatccaaaaaaagtagaattatctgtatacaaaaaaatttcaaaatcttat
tttgcggctattcccaattctatagaacccataatcacagatttacatcaagtaaaaaat
atattaaattctttgtgtaaagagatggataaaagatatgctcttttagaaaaatataag
gttagaaatattcaagaatacaatcaaaaatatcatttaccttatatcatactaatcatt
gatgaatttgcagacttaagtttttctttttatcaaaaaaaacaaatagaaacatatata
actcgattagctcagctggctcgtgctgtaggtattcatttgataatagcaacacaacga
ccatccgttgatgttattactggattaatcaaatccaatttcactgcacgaattgcattt
cgagtaagttctaaaatagattctagaaccatattagattgttcaggagctgaacaatta
ataggaaaaggagatctattattttctaatagaaatgaattgattcggttacaatgtccc
tttattgatttatcagatattcaaaaaatcgttgatttttacaaaaaaaatgataaaaaa
aacgaatatttctttcttccagaacctgactaa

DBGET integrated database retrieval system