KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_337Help
Entry
BLBBGE_337        CDS       T00995                                 

Gene name
rpsF
Definition
(GenBank) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Pathway
bbl03010  Ribosome
Module
bbl_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BLBBGE_337 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bbl03011]
    BLBBGE_337 (rpsF)
   03029 Mitochondrial biogenesis [BR:bbl03029]
    BLBBGE_337 (rpsF)
Ribosome [BR:bbl03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    BLBBGE_337 (rpsF)
  Bacteria
    BLBBGE_337 (rpsF)
Mitochondrial biogenesis [BR:bbl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BLBBGE_337 (rpsF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S6
Motif
Other DBs
NCBI-ProteinID: ACY40348
UniProt: D0JB10
Position
335839..336189
Genome map
AA seq 116 aa AA seqDB search
MLKHYENIMIITPILSDDQAKETAKEYENYLIQKKGKIVYQEHWGLKKLAYPIQKKQSGC
YHLFEFLLNPNLVSDLELKLRQDEHILRFLTIKLNKYGIEYAERRRKKLFKKDEEL
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaacattatgaaaatatcatgataatcactcctatattatctgatgatcaagca
aaagaaacagcaaaagaatatgaaaattatcttatccaaaaaaaaggaaagatagtttat
caggaacattggggattaaaaaaactagcttatcctattcaaaaaaaacaaagtggttgt
tatcatttatttgaatttttgttgaaccctaatttagtttctgatttagaattaaaatta
agacaagatgaacatattttacgttttttaactataaaactaaataaatatggaatagaa
tatgcagaaaggagaagaaaaaaattattcaaaaaagatgaagaattatga

DBGET integrated database retrieval system