KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_337Help
Entry
BLBBGE_337        CDS       T00995                                 

Gene name
rpsF
Definition
(GenBank) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl03010  Ribosome
Module
bbl_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:bbl00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    BLBBGE_337 (rpsF)
Ribosome [BR:bbl03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    BLBBGE_337 (rpsF)
  Bacteria
    BLBBGE_337 (rpsF)
Mitochondrial biogenesis [BR:bbl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BLBBGE_337 (rpsF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S6
Motif
Other DBs
NCBI-ProteinID: ACY40348
UniProt: D0JB10
Position
335839..336189
Genome map
AA seq 116 aa AA seqDB search
MLKHYENIMIITPILSDDQAKETAKEYENYLIQKKGKIVYQEHWGLKKLAYPIQKKQSGC
YHLFEFLLNPNLVSDLELKLRQDEHILRFLTIKLNKYGIEYAERRRKKLFKKDEEL
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaacattatgaaaatatcatgataatcactcctatattatctgatgatcaagca
aaagaaacagcaaaagaatatgaaaattatcttatccaaaaaaaaggaaagatagtttat
caggaacattggggattaaaaaaactagcttatcctattcaaaaaaaacaaagtggttgt
tatcatttatttgaatttttgttgaaccctaatttagtttctgatttagaattaaaatta
agacaagatgaacatattttacgttttttaactataaaactaaataaatatggaatagaa
tatgcagaaaggagaagaaaaaaattattcaaaaaagatgaagaattatga

DBGET integrated database retrieval system