KEGG   Blattabacterium Bge (Blattella germanica): BLBBGE_341Help
Entry
BLBBGE_341        CDS       T00995                                 

Gene name
pheA
Definition
(GenBank) prephenate dehydratase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
bbl  Blattabacterium Bge (Blattella germanica)
Pathway
bbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01130  Biosynthesis of antibiotics
bbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLBBGE_341 (pheA)
Enzymes [BR:bbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     BLBBGE_341 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT CXCR4_N
Motif
Other DBs
NCBI-ProteinID: ACY40352
UniProt: D0JB14
Position
338468..339304
Genome map
AA seq 278 aa AA seqDB search
MKKIAIQGVKGCFHHAAVSRYFEGCNYKLMECSSFREVAVSVAKSNVDIGVMAIENTIAG
TILTNYSLLSEYNLKIVGEIYIPIQHHLMAYPGQKIEDIKEIYSHSMAILQCELFIDAHP
FIKISEYSDTAAAAKYISICKKKGLAAIASENAAKEYGLEIISKNIQTITRNFTRFFIIK
NCYKQENASFNKASLRFKILHTTGSLSQILSLISSLGINMTKIQSIPIIQRPWEYSFYVD
IIFNNIKSYEKMKKCIQKIPCLHKWSIMGEYQNGRIRS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagctatacaaggggtaaaagggtgttttcatcatgcagccgtttccaga
tattttgaaggatgtaattataaattgatggaatgttcttcttttagagaagtagctgtt
tccgttgctaaatccaatgtagatattggagttatggctatagaaaataccatagcgggt
acaatattgaccaattacagtcttttatctgaatacaatttgaaaatagtaggagagata
tatatccccatacaacatcatttaatggcttatccagggcaaaaaatagaagatattaaa
gaaatctattctcattcaatggctattttgcaatgtgaattattcatagatgctcatcct
tttataaaaatatctgaatactcagatacagcggctgccgctaaatatatttctatatgc
aaaaaaaaaggattagctgccatcgcgtctgaaaatgcggctaaagaatatggtttagaa
atcatttccaaaaatatacaaactattacaaggaattttacgagattttttatcattaaa
aattgttataaacaagagaatgcttcctttaataaagcttcactaagattcaaaatttta
catactactggaagtttatctcagattttaagtcttatatctagtcttggaatcaatatg
actaaaatacaatccattcctataatacaaagaccttgggagtattccttttatgtcgat
attatattcaataatataaaatcttatgaaaaaatgaaaaaatgcatccaaaaaattccc
tgtcttcataaatggtctattatgggagaatatcaaaatggtagaattagatcctaa

DBGET integrated database retrieval system