KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_342Help
Entry
BLBBGE_342        CDS       T00995                                 

Definition
(GenBank) transaminase
  KO
K10206  LL-diaminopimelate aminotransferase [EC:2.6.1.83]
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Pathway
bbl00300  Lysine biosynthesis
bbl01100  Metabolic pathways
bbl01110  Biosynthesis of secondary metabolites
bbl01130  Biosynthesis of antibiotics
bbl01230  Biosynthesis of amino acids
Module
bbl_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BLBBGE_342
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bbl01007]
    BLBBGE_342
Enzymes [BR:bbl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.83  LL-diaminopimelate aminotransferase
     BLBBGE_342
Amino acid related enzymes [BR:bbl01007]
 Aminotransferase (transaminase)
  Class I
   BLBBGE_342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACY40353
UniProt: D0JB15
Position
339304..340458
Genome map
AA seq 384 aa AA seqDB search
MIIAAKKMFQVSEYFFSEKMKEINLLEKKGVKVINLGIGNPDLLPPKGVIHKMKKASELK
HANTYQSYIGIEELRNAISDWYRKEYQVDVDPKSEVLPLMGSKEGIMHISMSYLDKGDQV
LIPNPGYPTYSSISRLLEAEIIYYNLYEYENWSPNIHLLEKNNLSKIKIMWINYPHMPTG
ATISLENLEKIVFFAKKNRILLVHDNPYSFILNSERPLSIFNVKGSKDIALELNSLSKSY
NMPGWRVGMIIGKKEFIKNILKVKSQMDSGMYYPIQIGAIEAMNHNSKWFQKLNREYIQR
RKIIWEICDYLNLKYSKESSGIFVWARITGSEKNDRIWSDEFFNTHHIFITPGRVFGNNG
KGYVRFSMCCPVKILEQAKNRIFS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgattatagctgcaaaaaaaatgtttcaagtatcggaatactttttttccgaaaaaatg
aaggaaattaatcttcttgaaaaaaaaggtgtcaaagtcattaatttaggaattggaaat
ccagatctacttcctccaaaaggagtgatccataaaatgaaaaaagcgtcagaactcaag
catgcgaatacttatcaaagctatattggaatagaagaattacgtaatgcaatttctgat
tggtatagaaaagaatatcaagttgatgtagatcctaaaagtgaggttttgccattaatg
ggttctaaggaaggaattatgcatataagcatgtcttatttagacaaaggggatcaagtt
ttaattccaaatcctggatatcctacttattcatctatatcaagacttttggaagcagaa
attatttattataatctttatgagtatgaaaattggtctcccaatattcacttgttagaa
aagaacaatctttctaaaatcaaaataatgtggatcaattatcctcacatgcctacgggt
gcaacaatttctttggaaaacttagaaaaaattgttttttttgcgaaaaaaaaccgtatt
ttactcgttcatgataacccttatagttttatattaaatagtgaacgtcctttaagtatt
tttaatgtaaaaggatctaaagatatagccttagaattgaattcgttaagcaaaagttac
aatatgccaggatggcgtgtaggaatgataataggaaaaaaagaatttattaagaatata
ctaaaagtaaaaagtcaaatggattctggcatgtattatcccatacaaattggagctata
gaagctatgaatcataattctaagtggtttcaaaaactgaatagagaatatattcaacgc
agaaaaataatatgggaaatctgtgattatctaaacttgaaatattcaaaagaaagttcc
ggaatatttgtttgggcaagaataaccggttcagaaaaaaatgatcgaatatggtccgat
gaatttttcaatactcatcacatatttattacacctggaagagtgtttggaaacaatggg
aaaggatatgtaaggttttctatgtgttgtcccgtaaaaattttggaacaagcaaaaaat
agaattttttcatga

DBGET integrated database retrieval system